KEGG   Algoriphagus sp. M8-2: AO498_04675Help
Entry
AO498_04675       CDS       T04334                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
alm  Algoriphagus sp. M8-2
Pathway
alm00380  Tryptophan metabolism
alm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alm00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    AO498_04675
Enzymes [BR:alm01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     AO498_04675
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5
Motif
Other DBs
NCBI-ProteinID: AMQ55689
UniProt: A0A142EKN4
LinkDB All DBs
Position
complement(1049454..1050740)
Genome map
AA seq 428 aa AA seqDB search
MNPNTFEYSESFAREMDAKDKLAHFRTRFHFPKVEGKEAIYFCGNSLGLQPKSVKDYLGK
ELSNWADLAVDGHFHGEDAWYHIRKKSKPALAEILGAQEHEVVAMNNLSVNLHLLMVSFY
RPTKERYKIIVEAGAFPSDQYMLETQIKFHGLNPENVLLELSPRTGEHTLRTEDILAEIR
IHGDSLAMVNMSGIQYYTGQLFDLKAITAAAHEVGAMAGFDLAHAAGNAVLKLHDWEVDF
ATWCSYKYLNSGPGNVSGIFVHERYAERPDLPRFAGWWGHDEGERFRMEKGFVPMHGADG
WQLANSNVLALAAHQASLDIFQEAGMENLRAKSERLTAYLEFLIEHISGNSGVLEIITPK
NPAERGCQLSLLIHRGGKAVFDEFYKHGVVGDWRNPNVIRLAPTPLYNSYLDVFRFATIL
EQSLEKFA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaaatacatttgaatactccgaatcttttgcacgagaaatggatgcaaaagat
aagcttgctcatttccgaacccgatttcattttcctaaagtagagggtaaagaagccatt
tatttttgcggcaattctcttggtctacaaccaaaatccgtcaaagactatttgggaaaa
gagttaagtaattgggcggacctagcggtggatggacactttcatggagaagatgcttgg
tatcatatccgtaaaaagtcaaaaccggctttagccgaaattttgggcgcacaggagcat
gaagtggtggccatgaacaatctttcggttaatcttcacctgctgatggtttcattttat
cgtccgaccaaagagcgctacaagatcattgtagaagcaggagcttttccttcagatcag
tatatgctggaaactcagattaagtttcacggactcaatcctgaaaatgtattactagaa
ctcagcccaagaactggagaacatactcttcggacagaagacattttagcagaaatccga
atacatggagactctcttgccatggtgaatatgtcggggattcaatactacactggacaa
ctctttgatttaaaagccatcacggcagcagctcatgaagtgggcgctatggcaggtttt
gatcttgcccacgctgccggaaatgcagtcttaaaactccatgattgggaggtagacttt
gctacttggtgtagttataaatacctaaactcaggcccaggcaacgtttcaggaatattt
gttcatgaacgttatgcggaaagacccgacttgccccgttttgcaggatggtggggacac
gatgaaggagagcggttccgaatggaaaagggcttcgtacccatgcacggtgcagacggt
tggcaattagcaaactccaatgtcttggctttggcggctcatcaggcttctttggatatt
tttcaggaagctggcatggaaaatttgcgtgcaaaaagcgaacgattaacggcttacctt
gaatttctaatcgagcatatcagtggtaattccggtgtactggaaattatcactccaaaa
aatccagcggaaaggggctgccaattatctttgttgatacaccgaggcggaaaagccgtt
tttgatgaattttataaacatggtgttgtcggggactggagaaaccctaatgtaattcgc
ctagcccctactccactgtataacagctacttggatgttttccgatttgcaaccattttg
gaacaatccttggagaaattcgcttaa

DBGET integrated database retrieval system