KEGG   Algoriphagus sp. M8-2: AO498_04705Help
Entry
AO498_04705       CDS       T04334                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
alm  Algoriphagus sp. M8-2
Pathway
alm00564  Glycerophospholipid metabolism
alm01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alm00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AO498_04705
Enzymes [BR:alm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AO498_04705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored Pyr_redox_2 HI0933_like Pyr_redox_3 NAD_binding_8 Lycopene_cycl Thi4 GIDA FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AMQ55695
UniProt: A0A142EKP0
LinkDB All DBs
Position
complement(1055553..1057139)
Genome map
AA seq 528 aa AA seqDB search
MNREENIRQLSETSKTWDIAIIGGGSSGLGVALDAISRGLSVVLLEKADFAKGTSSRSTK
LVHGGVRYLAQGDISLVLEALKERGMLLKNAPHLTENQPFIIPIYSWWDRIQYSAGLKIY
DWMAGRLRLGKSHFISKNETIRRLPAVNQSKLKGGVVYHDGQFDDARLALNIAQTADELG
ACVLNYMKVTSLIKDPSGKLTGLHAIDSVSKKRFEIKAKMIVNATGVFADKILQMDNPEA
PKTIQPSQGIHLVMDLSFLGGKDALMIPKTRDGRVLFAVPWHGQLVVGTTDTLREKPKLE
PEALQKEIDFVLETASGYLTKKPTRADVKAVFAGLRPLARPKEGSTKTKEISRSHKVIVS
ESGLVSLTGGKWTTFRKMGEDTVDYFTQITSKSIAPSKSLNQKIHGHTTDLPSGHWKIYG
SDASKIQALAKTHAEWSELIHPNFPNILAEVAWSCQNEMAIKVEDVLSRRIRMLILDAQA
ALDSAKKVAQVMATVLNKDQSWIDTELEDFRKTATKYLINPSSKPLHT
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaacagagaagaaaacattaggcaattaagcgaaacgtctaaaacttgggatattgcc
ataatcggcggaggatcttccggattgggagtggcattggacgccataagccgggggctt
tcggttgtcttattagaaaaggctgattttgccaagggcacttccagccgaagcaccaag
ttggttcatggcggagtccgataccttgcccaaggagatatttcgttggttttggaagcg
ctaaaagagcggggaatgcttttgaaaaatgctcctcatctaaccgaaaaccaacccttt
attattcctatctattcttggtgggatcgaattcagtatagtgcagggttaaagatttac
gattggatggcagggagattacgccttgggaaatctcactttatttcaaaaaatgaaact
attcgccggcttcccgctgtaaatcaatcgaaactgaaaggcggagttgtctatcacgat
gggcaatttgacgatgctcgattggcattgaatattgcacaaactgccgatgagctcgga
gcttgtgtgctgaactatatgaaagtaaccagcctcatcaaggatccttctggcaaactt
accgggctacatgcaatcgacagtgtttccaaaaaacggtttgagatcaaagccaaaatg
atagtcaatgccacgggtgtttttgcagataaaatcctgcaaatggataatccggaggcc
ccaaaaaccatccaacccagccaagggattcatttggtgatggatctaagttttttaggc
ggaaaagatgctttgatgattccaaaaaccagagatgggagagtgcttttcgcagtacct
tggcatggtcagttggtagtaggaactaccgacacgcttcgggaaaaacccaaattggaa
cctgaagctttgcagaaggaaatagattttgtgctcgaaactgcaagtggctacctaact
aaaaaaccaacaagagctgatgtaaaggcagtttttgccggacttagacctctcgcccga
ccgaaggaaggaagcaccaaaaccaaggaaatttcaagatctcacaaggtaattgtctcc
gaaagtggactcgtgagtctgactggaggcaaatggaccaccttccgaaaaatgggcgaa
gatacagtggactatttcactcaaattacctcaaaaagcattgctccaagtaaatctctg
aaccaaaaaatccatgggcacaccaccgacttaccttccggccattggaaaatctacggt
tcagatgcctcaaaaattcaagcacttgctaagacacatgctgaatggtcagaattaata
catcccaactttccaaatatccttgctgaagtcgcttggtcctgtcaaaacgagatggcg
atcaaagtagaagatgttctttccagaagaattcgtatgttgattctcgatgcgcaggca
gcgttagattcagcgaaaaaagtagctcaagttatggcgacagttttaaataaagatcaa
tcttggatcgacactgaacttgaggatttcagaaaaactgccacaaaatacttgataaac
ccatcgtctaaaccattgcatacctaa

DBGET integrated database retrieval system