KEGG   Algoriphagus sanaruensis: AO498_13355
Entry
AO498_13355       CDS       T04334                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
alm  Algoriphagus sanaruensis
Pathway
alm00010  Glycolysis / Gluconeogenesis
alm00020  Citrate cycle (TCA cycle)
alm00620  Pyruvate metabolism
alm01100  Metabolic pathways
alm01110  Biosynthesis of secondary metabolites
alm01120  Microbial metabolism in diverse environments
alm01200  Carbon metabolism
Module
alm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:alm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AO498_13355
   00020 Citrate cycle (TCA cycle)
    AO498_13355
   00620 Pyruvate metabolism
    AO498_13355
Enzymes [BR:alm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AO498_13355
SSDB
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PYNP_C GCV_H
Other DBs
NCBI-ProteinID: AMQ57429
UniProt: A0A142EQM4
LinkDB
Position
complement(3038747..3040387)
AA seq 546 aa
MAEIIRMPKMSDTMEEGVIAAWLKKVGDQVKPGDILAEVETDKATMELESYEEGTLLYIG
VQEKDSVPVNGIIAIIGEKGEDYKHLLEGGSSAAPAKKEEAPQAAPTAPQSAPAPAEKID
TSSINATVITMPKMSDTMQEGTIATWLKKVGDAVKSGEIIAEVETDKATMELESYEDGVL
LYIGVEAGNSVPVDGVIAVIGEKGADFNTLLKAHQTSGSAAEPVAESKPSAAPSQEQAPA
PSVAASPAPTAAPVSSNSNERVKASPLAKKIAQDKGLDIRQVAGSGEGGRIVKKDVENFV
PAAAPAVAAPAATSAPVLGQESFREEKVSQMRKTIAKRLAESKYSAPHFYLTMEINMDKA
IEARKSMNEISPVKISFNDMVIKAAAAALRQHPKVNSSWLGDKIRYNDHIHIGMAVAVEE
GLLVPVIRFADSLSLSQISNQAKTLGAKAKNKELQPKDWEGNTFTISNLGMFGIDEFTAI
INPPDACILAVGGIKETVVVKDGQMKIGNVMKVTLSCDHRVVDGAVGSAFLLTLKGLLED
PVRILI
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggccgaaattatcagaatgccgaaaatgagtgacaccatggaagaaggtgtcatcgcg
gcatggttaaaaaaagtgggggatcaagtgaagcctggagacatcctagctgaagtggag
acggacaaggcaaccatggaactggagtcttacgaagaaggaaccctactatatattgga
gtacaggaaaaagattccgtgcctgtcaacggcatcatcgccattattggtgagaaaggt
gaggattataaacatcttttggaaggtggatcatctgcagctcctgccaaaaaagaagaa
gctcctcaagctgctcctaccgcacctcaatctgccccagctcctgctgaaaaaattgac
acttcatccattaatgcaacagtcatcaccatgcctaaaatgagtgatactatgcaagag
ggtaccatagctacttggcttaagaaagtgggagatgcggtcaaatctggtgaaatcatt
gctgaagtagaaactgataaagctactatggaattggaatcctatgaagatggggttctc
ttatatataggtgtggaagcaggaaatagtgtccctgtcgatggtgtaattgctgtcatc
ggagaaaagggagcagatttcaatacccttcttaaggctcaccaaactagtggatctgct
gctgaacctgttgctgaatccaagccaagtgcggctccaagtcaggaacaagcacctgca
ccttcagtggcagcgtcacctgcacctacagctgctccggtttcttcaaattccaatgag
cgcgtaaaagcttctccacttgcaaaaaagatagcacaagacaaaggcttggacattcgt
caagtcgctggttcaggcgagggtggaaggattgttaaaaaagacgttgaaaactttgtg
cctgccgctgcacctgcagttgctgcacctgccgctacaagtgctcctgttttaggacaa
gaaagcttccgtgaagaaaaagtctctcaaatgagaaaaacaatcgcgaagcgtttggca
gaaagtaaatactctgctcctcacttttaccttaccatggaaatcaacatggataaggca
attgaggcaagaaagagcatgaatgagatttctccggttaagatttcattcaatgatatg
gtaatcaaggctgctgctgctgctttgagacagcatccaaaagtgaattcaagctggtta
ggagataaaatcagatacaacgaccatatccatatcgggatggcagttgcagttgaggaa
ggtttgctagtgcctgtaatcagatttgcggatagcttgtcactttctcaaatctctaat
caagccaagactttaggagcaaaagcaaaaaataaagagcttcagccaaaggattgggaa
ggaaataccttcaccatctccaatttgggaatgttcggaatcgatgagtttactgcgatt
atcaacccacctgatgcttgtattctagcggtaggaggtatcaaggaaactgttgtggtg
aaagacggccagatgaagattggaaatgtgatgaaagtgaccctttcttgtgaccatcga
gttgtagacggagccgttggttcagcatttttgttaactctgaaaggcctacttgaggac
ccggttcgaatacttatctaa

DBGET integrated database retrieval system