KEGG   Algoriphagus sp. M8-2: AO498_13355Help
Entry
AO498_13355       CDS       T04334                                 

Definition
(GenBank) pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
alm  Algoriphagus sp. M8-2
Pathway
alm00010  Glycolysis / Gluconeogenesis
alm00020  Citrate cycle (TCA cycle)
alm00620  Pyruvate metabolism
alm01100  Metabolic pathways
alm01110  Biosynthesis of secondary metabolites
alm01120  Microbial metabolism in diverse environments
alm01130  Biosynthesis of antibiotics
alm01200  Carbon metabolism
Module
alm_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:alm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AO498_13355
   00020 Citrate cycle (TCA cycle)
    AO498_13355
   00620 Pyruvate metabolism
    AO498_13355
Enzymes [BR:alm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     AO498_13355
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 DUF2118 PYNP_C GCV_H
Motif
Other DBs
NCBI-ProteinID: AMQ57429
UniProt: A0A142EQM4
LinkDB All DBs
Position
complement(3038747..3040387)
Genome map
AA seq 546 aa AA seqDB search
MAEIIRMPKMSDTMEEGVIAAWLKKVGDQVKPGDILAEVETDKATMELESYEEGTLLYIG
VQEKDSVPVNGIIAIIGEKGEDYKHLLEGGSSAAPAKKEEAPQAAPTAPQSAPAPAEKID
TSSINATVITMPKMSDTMQEGTIATWLKKVGDAVKSGEIIAEVETDKATMELESYEDGVL
LYIGVEAGNSVPVDGVIAVIGEKGADFNTLLKAHQTSGSAAEPVAESKPSAAPSQEQAPA
PSVAASPAPTAAPVSSNSNERVKASPLAKKIAQDKGLDIRQVAGSGEGGRIVKKDVENFV
PAAAPAVAAPAATSAPVLGQESFREEKVSQMRKTIAKRLAESKYSAPHFYLTMEINMDKA
IEARKSMNEISPVKISFNDMVIKAAAAALRQHPKVNSSWLGDKIRYNDHIHIGMAVAVEE
GLLVPVIRFADSLSLSQISNQAKTLGAKAKNKELQPKDWEGNTFTISNLGMFGIDEFTAI
INPPDACILAVGGIKETVVVKDGQMKIGNVMKVTLSCDHRVVDGAVGSAFLLTLKGLLED
PVRILI
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atggccgaaattatcagaatgccgaaaatgagtgacaccatggaagaaggtgtcatcgcg
gcatggttaaaaaaagtgggggatcaagtgaagcctggagacatcctagctgaagtggag
acggacaaggcaaccatggaactggagtcttacgaagaaggaaccctactatatattgga
gtacaggaaaaagattccgtgcctgtcaacggcatcatcgccattattggtgagaaaggt
gaggattataaacatcttttggaaggtggatcatctgcagctcctgccaaaaaagaagaa
gctcctcaagctgctcctaccgcacctcaatctgccccagctcctgctgaaaaaattgac
acttcatccattaatgcaacagtcatcaccatgcctaaaatgagtgatactatgcaagag
ggtaccatagctacttggcttaagaaagtgggagatgcggtcaaatctggtgaaatcatt
gctgaagtagaaactgataaagctactatggaattggaatcctatgaagatggggttctc
ttatatataggtgtggaagcaggaaatagtgtccctgtcgatggtgtaattgctgtcatc
ggagaaaagggagcagatttcaatacccttcttaaggctcaccaaactagtggatctgct
gctgaacctgttgctgaatccaagccaagtgcggctccaagtcaggaacaagcacctgca
ccttcagtggcagcgtcacctgcacctacagctgctccggtttcttcaaattccaatgag
cgcgtaaaagcttctccacttgcaaaaaagatagcacaagacaaaggcttggacattcgt
caagtcgctggttcaggcgagggtggaaggattgttaaaaaagacgttgaaaactttgtg
cctgccgctgcacctgcagttgctgcacctgccgctacaagtgctcctgttttaggacaa
gaaagcttccgtgaagaaaaagtctctcaaatgagaaaaacaatcgcgaagcgtttggca
gaaagtaaatactctgctcctcacttttaccttaccatggaaatcaacatggataaggca
attgaggcaagaaagagcatgaatgagatttctccggttaagatttcattcaatgatatg
gtaatcaaggctgctgctgctgctttgagacagcatccaaaagtgaattcaagctggtta
ggagataaaatcagatacaacgaccatatccatatcgggatggcagttgcagttgaggaa
ggtttgctagtgcctgtaatcagatttgcggatagcttgtcactttctcaaatctctaat
caagccaagactttaggagcaaaagcaaaaaataaagagcttcagccaaaggattgggaa
ggaaataccttcaccatctccaatttgggaatgttcggaatcgatgagtttactgcgatt
atcaacccacctgatgcttgtattctagcggtaggaggtatcaaggaaactgttgtggtg
aaagacggccagatgaagattggaaatgtgatgaaagtgaccctttcttgtgaccatcga
gttgtagacggagccgttggttcagcatttttgttaactctgaaaggcctacttgaggac
ccggttcgaatacttatctaa

DBGET integrated database retrieval system