KEGG   Algoriphagus sp. M8-2: AO498_14315Help
Entry
AO498_14315       CDS       T04334                                 

Definition
(GenBank) phosphoenolpyruvate carboxylase
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
alm  Algoriphagus sp. M8-2
Pathway
alm00620  Pyruvate metabolism
alm00680  Methane metabolism
alm01100  Metabolic pathways
alm01120  Microbial metabolism in diverse environments
alm01200  Carbon metabolism
Module
alm_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:alm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AO498_14315
  09102 Energy metabolism
   00680 Methane metabolism
    AO498_14315
Enzymes [BR:alm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     AO498_14315
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-ProteinID: AMQ57622
UniProt: A0A142ER67
LinkDB All DBs
Position
complement(3275714..3278245)
Genome map
AA seq 843 aa AA seqDB search
MFQVYDTQVAKRFTIYNSLFLDLPFDDIYRTGTLLPTLATACQKGFQSGKTPREIITGFF
EEMMPNHSEKERHDLLFQMIQYVERQVVLFDSIEDAAYEKINDLKGKGSIKALIDRADND
HKREELIEKLKTFSVRLTLTAHPTQFYPGNVLGIITDLEKAIRNDDLGDINLLLMQLGKT
GFINREKPTPLDEAVSLIWFLENVFYQSISDIMIRLLKSLNQPLHTWENPGLLKVGFWPG
GDRDGNPFVTHETTLNVAERLKKWILRCYYRDIRNLRKRLTFKHVEPIILKAEQGIFSTL
FDNKIVYHSKEELLQDLLEARNGLVTYHNGLFLDLLDEFILKVRIFGFHFAHMDLRQDSR
KHDSLWGEIFQLQGRDFDGNEDQLIQALLKTLSLPAIDKFQDSFHREMLESFGTIRAVQQ
SNGEEGLHRYIISNCQSALHVMEVFQLSRLTMDQSKNLPLDIVPLFETIDDLQAAPEIMA
KLYSNPDYRAHLKERGNKQTVMLGFSDGTKDGGYLKANWSILRAKEELTRASREYDVQVV
FFDGRGGPPARGGGNMHNFYASLGQKVENAEIQVTIQGQTISANYGKQASCTYNFEQLLS
AGLENHLYSDAERNLSDAQRALIDELADMGYDAYKKLKSHPKFVPYLEHVTPLKYFGMTN
VGSRPLKRGKGSGLKFEDLRAIPFVGSWAQMKQNIPGFYGVGAAIEQMKEQGRLDELKKL
YRESLFFRTLLGNSMQSLTKSFYPATEYLKDNVEYGEFWNILFAEYTRSIDMLKQISEMK
ELMGDNPVSKTSIEIREKIVLPLITIQQFAIQTLLDSKIEDQSLQRLILRSMFGIINAAR
NAA
NT seq 2532 nt NT seq  +upstreamnt  +downstreamnt
atgtttcaagtctatgatacgcaagtcgctaagcgatttacgatttataacagtctcttc
ttagatcttccttttgatgatatttatcgaacggggacgcttttgcctactttggccact
gcttgccaaaaaggatttcaatcaggaaaaactccgagagagatcattaccggttttttt
gaagaaatgatgcccaatcattctgaaaaagagcggcatgatcttctatttcaaatgatc
cagtatgtggagcggcaagtggtactttttgattcgattgaagatgcagcttatgaaaaa
atcaatgacctaaaaggaaaaggttcgatcaaggcgcttatcgatcgtgcggataatgat
cacaagagagaagagttgattgaaaaactaaagaccttttcagttcgacttaccctaact
gcacatcctacgcagttttatcccggtaatgtccttgggataatcactgatttggaaaaa
gcgatccgaaatgatgatttgggggatatcaatctcctgctcatgcaactgggtaaaaca
ggatttatcaatcgggaaaaacccactccattggatgaggcagtcagtttgatttggttt
ttggaaaatgtattctatcagagcatttctgatattatgattcgcttacttaagtcgttg
aatcaaccccttcatacttgggaaaatccgggcttacttaaggttgggttttggccaggg
ggagatcgtgacggaaatccatttgtaacgcatgaaaccaccttgaatgtggctgaaagg
ctcaaaaagtggattttaagatgctattaccgggatattagaaatctccgaaagcgattg
actttcaagcatgtcgagcccattattctcaaagccgaacaagggattttttctaccctg
tttgacaataaaattgtgtaccactctaaggaagagcttttgcaggatttacttgaagct
agaaatggattggtgacctatcacaatggtctgtttttggatctgctggatgagtttatc
ctgaaggttcgaatttttggatttcactttgctcacatggatctccggcaggatagtagg
aagcacgatagtttatggggtgaaatatttcagcttcagggaagggactttgatgggaat
gaggatcaactaatccaagcactactcaaaacactttcactgccagctatagataagttt
caggattcctttcatcgggaaatgttagagtctttcgggaccattcgagccgttcaacaa
tccaatggggaggagggacttcatcggtacattatttccaattgccagtcggcccttcat
gtgatggaagtttttcaattgagccgattgaccatggatcagtcaaaaaatctcccgctg
gatattgtgcctctttttgagactatcgatgatttacaggctgcccctgaaatcatggca
aaactttacagtaatccggattatcgcgctcatttgaaggagcgaggtaataagcaaacg
gtaatgcttggtttttcggatgggaccaaagatggtggctatctaaaggccaactggtct
atcttgagagcgaaagaggagcttacccgagcatcaagagaatatgatgttcaagttgta
ttctttgatggtagagggggacctcctgctcgaggtggagggaatatgcataatttctat
gcctctttgggtcaaaaagtggaaaatgccgaaatccaagtgactattcaaggtcagact
atttcagcgaattacggaaagcaggcttcttgtacctataattttgagcaactactcagt
gctggtttggaaaatcatctgtattcggacgcagagcgaaatctttcggatgcccagcgt
gcacttatcgatgaattggcggatatgggctatgatgcttataaaaagttaaagtctcat
ccgaaatttgtgccctatctcgagcatgtgacccctttgaagtattttggaatgaccaat
gtaggttctagaccgctcaaacggggaaaaggctcaggattaaaatttgaggatcttcgt
gcaattccgtttgtgggtagctgggcgcagatgaagcaaaacatccctggtttctatggt
gtaggagctgctattgaacaaatgaaagagcagggcagattagatgagttgaaaaaacta
tatcgggaaagcctattttttagaaccttattgggtaattcgatgcagtcgctgactaag
agcttttatccggctactgaatatcttaaagacaatgtggaatacggggagttttggaat
attctttttgctgaatatacccgttcgattgatatgctgaagcaaatttccgaaatgaag
gaactgatgggagataatcctgtaagcaaaacttctattgaaattcgagagaaaattgtt
cttcctttgattaccattcaacagtttgcgattcaaactttattggattcaaagatcgaa
gaccaatccttgcaacggcttattttaaggtccatgtttggaatcatcaatgccgcaaga
aacgctgcttaa

DBGET integrated database retrieval system