KEGG   Algoriphagus sp. M8-2: AO498_15685Help
Entry
AO498_15685       CDS       T04334                                 

Definition
(GenBank) alpha-glucosidase
  KO
K21574  glucan 1,4-alpha-glucosidase [EC:3.2.1.3]
Organism
alm  Algoriphagus sp. M8-2
Pathway
alm00500  Starch and sucrose metabolism
alm01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alm00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AO498_15685
Enzymes [BR:alm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     AO498_15685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_97 GH97_N GH97_C
Motif
Other DBs
NCBI-ProteinID: AMQ57895
UniProt: A0A142ERZ0
LinkDB All DBs
Position
complement(3601383..3603521)
Genome map
AA seq 712 aa AA seqDB search
MCRKSLSTLFLILFGAISIHSQTLLSPGKNLELTFQLSPKGAPIYSVKIGGEPIIQPSSL
GFDLKNDEIDLLDGFVISQTATSTIDETWTPVWGEENQIRNHANELMVELTQSQTGRKMI
LRFRAFDEGVGFRYEFPLQEKMGYFVIKEEKSQFAMTGDHTAFWIPGDYDTQEYDFTESK
LSEIRGLMKTAITPNASQTPFSDTGVQTALMMKSADGWYINLHEAALIDYPAMHLELDDQ
AMVFTSHLTPDAVGDKGYLYTPTQTPWRTIIASKNAGDVLASRITYNLNEPSKIENTTWI
KPMKYVGVWWEMITGKSSWSYTNDFKAIKLGETDYSKATPNRTHGATTANVKKYIDFAAK
HGFDGVLVEGWNVGWEDWFGNSKDYVFDFLTPYPDFDLKGIAEYAREKGVKMIMHHETSS
SVRNYERHMDKAYQLMKDYGYPAVKSGYVGDMIPRGEYHYSQWLVNHYQYAIEKAAEYEL
MVNAHEAVRPTGVARTWPNLIGNESARGTEYQAFGGSKANHVTILPFTRQIGGPMDYTPG
VFEMDVYNGSHVNSTLANQLALYVTLYSPLQMAADFPENYDRFPDAFQFIKDVALDWEKS
LYLEAEPGYYVTIARKAKGSGEWFVGNVNGFEGRTGMVKFDFLEEGKTYLAEIYADKSDA
HFKTNPQSYEIKKMAVDAKSVLKQFSAPGGGYAIRIRAASKEDLKGIKKLKS
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgtgtagaaaaagcttgtccaccctgtttttgattttattcggagcgatttcaattcat
tcgcaaacgctcctttctcctggaaaaaatcttgaattgacgtttcaattaagtccaaaa
ggagcccccatttattctgtgaaaattggaggcgaaccgattattcaacccagtagcctt
gggtttgatttaaaaaatgacgagatcgatctccttgatggatttgtaatttcccaaact
gccacttcgaccattgatgaaacctggactccagtatggggagaagagaatcagatcaga
aatcatgcgaacgaactgatggtggaattgacccaatctcagacgggccgtaaaatgatc
cttcgctttcgagcctttgatgaaggggtaggctttcgatacgagtttcctttgcaagaa
aagatgggctatttcgtgatcaaggaagaaaaatcccagttcgctatgactggagatcat
actgcattttggatccccggcgattacgatacacaggagtatgattttaccgagtccaaa
ctaagtgagatcaggggtttgatgaagacagccattacaccaaatgcctcccagactccc
ttctcagatacgggcgtacaaactgccctaatgatgaaatctgcagatggatggtatatc
aatttacatgaggcggctttgattgattatcccgccatgcatttggagctggatgatcag
gcgatggtatttacgtcccatttgacgcctgatgccgttggggataagggatatttatat
acaccgacccaaactccttggagaacgattattgccagcaaaaacgctggagacgttttg
gcttctcggatcacttataatttaaacgaaccttccaaaattgaaaataccacatggatc
aaacccatgaaatatgtcggagtttggtgggaaatgattactgggaaaagttcttggtct
tacacaaatgatttcaaagcgatcaaacttggtgagacagattacagcaaagcaactcca
aaccgaactcacggcgccaccaccgctaatgttaaaaagtacattgactttgccgcaaaa
catggatttgatggtgttttagtcgaaggttggaatgtaggttgggaggattggtttggt
aattccaaggattatgtgtttgactttttgactccatatcctgactttgatctcaaagga
atcgctgaatatgcccgagaaaaaggagtgaaaatgatcatgcatcatgagacatcttct
tctgtgcgtaactatgagcgccacatggataaagcctatcagttgatgaaggactacggg
tatccagcagtgaaaagcgggtatgtaggagatatgattccaagaggagaatatcattac
agccagtggttggttaatcactaccaatatgcgatcgaaaaagcagctgaatacgagctc
atggtcaatgcccatgaagctgttcgtcctactggagtagcccgaacttggccaaactta
atcggtaacgaatctgctcgaggtacggagtatcaggccttcggaggaagcaaagcgaac
catgtgaccattttgcccttcacccgtcagattggtggaccgatggactataccccgggt
gtttttgaaatggatgtttataatggaagccatgtcaacagcactttggccaatcaattg
gcactttatgtgaccttgtactcgcctttacaaatggctgctgattttccggaaaattac
gatcgttttccagatgcttttcaattcatcaaggatgtggctttagactgggaaaagagt
ctttacttggaagccgagccggggtattatgttacaattgccagaaaagccaaaggatca
ggggagtggtttgtaggaaatgtcaatggattcgaaggtcgcacgggtatggtgaagttt
gactttttggaggaaggaaaaacctacctggcagaaatctatgcggataaatcagatgct
catttcaaaaccaatcctcaatcctatgagatcaaaaaaatggcggtagatgcgaagtct
gtgctgaagcagttttcggctcctggtggaggatatgcgatccgaatcagagccgctagc
aaagaggatttgaaaggaattaaaaaactgaagtcataa

DBGET integrated database retrieval system