KEGG   Alcanivorax sp. NBRC 101098: AS19_05450Help
Entry
AS19_05450        CDS       T03879                                 

Definition
(GenBank) aspartyl/glutamyl-tRNA amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
aln  Alcanivorax sp. NBRC 101098
Pathway
aln00970  Aminoacyl-tRNA biosynthesis
aln01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aln00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    AS19_05450
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:aln03029]
    AS19_05450
Enzymes [BR:aln01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     AS19_05450
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     AS19_05450
Mitochondrial biogenesis [BR:aln03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    AS19_05450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: BAP13396
LinkDB All DBs
Position
complement(581807..583282)
Genome map
AA seq 491 aa AA seqDB search
MHTKTLTELKAGLAAGDFSSRELTEHFLARIKQYDGELNSFVTVTEEQALAQADAADATL
ATNRASSSVSGLLTGLPIAHKDIFCTEGVRTSCGSKMLDNFIAPYTATVVEKMAAEGAVM
LGKTNMDEFAMGSSNETSYYGPVKNPWDLERVPGGSSGGAAACLGARLAPAATGTDTGGS
IRQPAALNNITGLKPTYGRVSRWGMIAFASSLDQAGPMAQSAEDCALMLQAMAGHDHRDS
TSLNEKVGDYLGALKDDIRGLTIGIPEEFFPDTLDGAIADNSRDAIRELEKLGAKVVSVS
LPSIKLSVPAYYVIAPAEASANLSRFDGVRFGHRCDDPQDLEDLYKRSRSEGFGDEVKRR
ILVGAYALSAGYYDAYYRRAQQVRRLIRDDFARAFEKVDVLMGPTAPETAFKLGAKKDDP
VSMYMADVFTIGVNLAGLPALSMPTGFINGLPTGTQIIGNYFREGQILNVAHKYQQATDW
HKQAPAFGGAQ
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgcataccaaaaccctgaccgaactcaaggctggcctagctgccggagatttttcctcc
cgcgagttgaccgaacacttcttggcccgcatcaaacagtatgacggcgaactcaacagc
tttgtcaccgtgaccgaggaacaagcactggcccaagcggatgccgccgatgcaaccctt
gccactaaccgtgcatcctcctcagtgagcggcctgctcaccggcctgcccatcgcccac
aaggatattttctgcaccgagggcgtgcgcaccagctgtggctcaaaaatgctggacaac
tttattgccccctacaccgccaccgtggtggaaaaaatggcggctgaaggcgccgtcatg
ctgggcaagaccaacatggacgagttcgccatgggctcctccaatgaaaccagttactac
ggcccagtgaaaaacccatgggatctagagcgggtgcctggcggctcctccggcggcgca
gccgcttgcctgggcgcccgcctagcgcctgctgctaccggcaccgacaccggcggctcc
attcgccaacctgcggcgctgaataacatcaccggcctcaaacccacctacgggcgagtc
tcacgctggggcatgattgcctttgcttccagcctggaccaagccggccccatggcccaa
agcgctgaagactgtgcgttgatgctgcaagccatggccggccacgatcaccgcgattcc
accagcctcaacgaaaaggtgggcgattatcttggcgcccttaaagacgacatccgcggc
ctgaccattggcatcccggaagagtttttcccagacaccctggatggcgctatcgccgac
aacagccgtgacgcgatccgcgaactggaaaaactcggcgcaaaagtagtatccgtctcc
ttacccagcatcaagctatccgtaccagcctactatgtgattgccccggcagaagccagt
gccaaccttagtcgttttgacggtgtacgtttcggccatcgatgtgatgacccacaggat
ctggaagacctgtacaagcgctctcgctcagaagggtttggtgatgaagtaaaacggcgc
atcttagtcggcgcctacgcgctgtccgctggttactacgacgcatactatcgccgcgcc
caacaagtgcgccgtttaatccgtgacgactttgcccgcgcctttgaaaaagtagatgta
ctgatgggacccacagcgcctgaaaccgccttcaagctcggagcgaagaaagatgatccg
gtcagcatgtacatggccgacgtgttcaccatcggcgttaacttagccggccttcctgcg
ctgtccatgcccacgggattcatcaacggcctgcccaccggcacccagatcatcggcaac
tatttccgtgaagggcaaattcttaacgtggcccacaaataccagcaggccacagactgg
cacaaacaagcgccagcgtttggaggtgcacaatga

DBGET integrated database retrieval system