KEGG   Alcanivorax sp. NBRC 101098: AS19_13200Help
Entry
AS19_13200        CDS       T03879                                 

Definition
(GenBank) malate dehydrogenase
  KO
K00024  malate dehydrogenase [EC:1.1.1.37]
Organism
aln  Alcanivorax sp. NBRC 101098
Pathway
aln00020  Citrate cycle (TCA cycle)
aln00270  Cysteine and methionine metabolism
aln00620  Pyruvate metabolism
aln00630  Glyoxylate and dicarboxylate metabolism
aln00680  Methane metabolism
aln01100  Metabolic pathways
aln01110  Biosynthesis of secondary metabolites
aln01120  Microbial metabolism in diverse environments
aln01130  Biosynthesis of antibiotics
aln01200  Carbon metabolism
Module
aln_M00009  Citrate cycle (TCA cycle, Krebs cycle)
aln_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
aln_M00012  Glyoxylate cycle
aln_M00168  CAM (Crassulacean acid metabolism), dark
Brite
KEGG Orthology (KO) [BR:aln00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    AS19_13200
   00620 Pyruvate metabolism
    AS19_13200
   00630 Glyoxylate and dicarboxylate metabolism
    AS19_13200
  09102 Energy metabolism
   00680 Methane metabolism
    AS19_13200
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    AS19_13200
Enzymes [BR:aln01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.37  malate dehydrogenase
     AS19_13200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ldh_1_C Ldh_1_N Glyco_hydro_3_C
Motif
Other DBs
NCBI-ProteinID: BAP14171
LinkDB All DBs
Position
complement(1452618..1453598)
Genome map
AA seq 326 aa AA seqDB search
MKAPVRVAVTGAAGQISYSLLFRIASGDMLGKDQPVILQLLEITPALEALNGVIMELEDC
AFPLVAGITGTDDANVAFKDADYALLVGARPRGPGMERKDLLEANAAIFSAQGKAINDNA
SKGIKVLVVGNPANTNALIAQRNAPDIDPRQFTAMTRLDHNRAMAQLANKLGKTVNDVKK
MLIWGNHSSTQYPDLHHCEVDGKVAIDQVEQDWYENDYIPTVQQRGAAIIKARGASSAAS
AANAAVDHMRSWALGTDEGDWVSMGIYSDGSYGIQEGLIYSFPCTCKNGDWTIVQGLEVN
DFSRGKMQATEQELAEERDAVSHLLP
NT seq 981 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcacccgtacgcgtagccgtcaccggcgccgctggccaaatcagctattccctg
ctgttccgcatcgcttccggcgacatgcttggcaaagaccagcccgttattctgcaattg
ctcgaaatcacccctgctctggaagccctgaacggggtcatcatggagctggaagattgc
gcattcccgctggttgccggtatcaccggtaccgacgatgccaacgtggccttcaaagac
gccgactacgcgctgttggttggtgctcgtccgcgtggtccgggcatggagcgtaaagat
ctgctggaagctaacgcagccatcttctccgcccaaggcaaagccatcaacgacaatgcc
agcaaaggcatcaaggttcttgttgtcggcaacccggccaacaccaatgccctgatcgcc
caacgcaacgcgcctgacatcgatccccgtcagtttactgccatgacccgcctagaccac
aaccgtgccatggcgcaactggccaacaaattgggcaaaaccgtcaatgacgtgaagaag
atgctcatctggggcaaccactcttccactcagtatcctgatctgcatcactgtgaagtg
gatggcaaagtagccattgatcaggtcgagcaagactggtatgaaaacgactacatcccg
actgtacagcagcgtggtgcagcgatcattaaggcccgtggcgcgtcttctgccgcgtct
gctgctaacgctgccgtggaccacatgcgttcctgggcactgggcaccgacgaaggtgac
tgggtttccatgggcatctacagtgatggttcctacggcattcaggaaggcctgatctac
tccttcccttgcacctgcaagaatggcgactggactatcgttcagggcctagaggtcaat
gacttctcccgtggcaaaatgcaagccaccgagcaggaactggccgaagaacgtgatgct
gtttctcacctgctgccgtaa

DBGET integrated database retrieval system