KEGG   Alcanivorax sp. NBRC 101098: AS19_20190Help
Entry
AS19_20190        CDS       T03879                                 

Definition
(GenBank) penicillin-binding protein 2
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
aln  Alcanivorax sp. NBRC 101098
Pathway
aln00550  Peptidoglycan biosynthesis
aln01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:aln00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AS19_20190
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AS19_20190
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:aln01011]
    AS19_20190
Enzymes [BR:aln01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AS19_20190
Peptidoglycan biosynthesis and degradation proteins [BR:aln01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   AS19_20190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: BAP14870
LinkDB All DBs
Position
2228183..2230099
Genome map
AA seq 638 aa AA seqDB search
MRRPLTLKDHHHEQRIFSVRLVVSVFLVLLLTCVLIGRMIWLQIIEHNRYTTLSDNNRVQ
TQAVAPPRGLITDRNGEILADNRPDFSLEIIIEQAADLDQLLTELGNLIELDEGDRERFE
KRRHTARRPWEPVPLRGRLTEEEIARLVVNQHRLAGIRISADPIRHYPHGILFSHVLGYV
NRINVQDLDAMTLDQQRNYAGTHFYGRSGIERFYEDTLHGEVGYRQVETNARGRILRVLE
EQAPVPGKPLRLRLSMRVQKAAYDALGERRGAVVAIDPRDGSVLAFVSRPGFNPNLFVTG
ISYKDYSAYRNDHDNPLFNRALQGRYPPGSTIKPMYGLAGLDAGVTTWERTIFDPGYYQL
ENDPHRYRDWKRWGHGRVNLRDAVVQSCDTYFYDMGFKLGIERLHRYMTQFSLGQPTGID
LHNESSGIMPSKQWKKAARGRPWFHGDTINASIGQGFVLATPLQLANATAIMANHGKQVV
PTLAGDTKPVERTDIVLNDQSNWEKMADAMVGVTQLGGTARAMAVKAKYDIAAKSGTAQV
FSVGQDETYNEEELTERLLDHALLVSFAPADKPAIAVAVLVENGRHGGSTAGPVAREVMD
AWLLDEQGELKVPPVFAETPPHPPSNTTINNAGNENRP
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgaccattaacgctgaaggatcatcatcacgagcagcgcattttcagcgttcgt
cttgtcgtgagtgttttcctggtgttactgctcacctgtgtgttgatcgggcgcatgatc
tggttacagatcatcgaacacaatcgttacaccaccctcagtgacaacaaccgggttcag
acacaagctgtggccccaccgcgcgggctaattaccgaccgcaatggcgaaattcttgcc
gataaccgccctgatttttcgctggaaatcatcatcgagcaagcagctgatctggatcag
ctgctcaccgagctgggcaatcttatcgaactcgatgagggggaccgggaacgtttcgag
aaacgccgccataccgctcgccgcccctgggaacctgtgccactacgtggccggctcacc
gaagaagaaattgcccggctggtggtgaaccagcaccggctcgcgggtatcaggatctcc
gccgacccgattcgccactaccctcacggcattctgttttcccatgttttgggctacgta
aaccggatcaatgtccaagatttggacgcgatgactctagaccaacaacgcaactacgcg
ggcacccatttttacgggcgcagtggcatcgaacggttttatgaagataccctgcacggt
gaagttggctaccgccaagtagaaaccaatgctcgaggccgaatcttaagggtgctagaa
gagcaagcgccggtgccgggtaagcccctgcgacttcgcctttccatgcgagtgcaaaaa
gcagcttatgatgctttgggcgaacgccgtggcgccgtggtcgccattgatcctcgcgat
ggcagtgtgctggcattcgttagccggccaggctttaaccccaacctgttcgtcaccggc
atttcctataaagattattccgcctatcgcaacgaccacgacaaccccctgttcaaccgt
gcactgcaagggcgctacccaccaggttccaccatcaagcccatgtatggcctggccggg
ctcgatgccggggtaaccacctgggagcggaccatttttgatcccggatactatcagcta
gaaaacgaccctcaccgctaccgagactggaaacgctggggccatggtcgcgtcaatctg
cgcgatgcagtggtgcagtcctgcgacacctatttttacgacatgggctttaaactgggc
attgaacgcctacaccgctacatgacccagttttccctaggtcagcctaccggtatcgac
ctccacaacgaatccagcggcattatgccgtccaaacagtggaaaaaggccgcacgcggc
cgcccctggttccacggtgacaccatcaacgccagcattggccagggatttgtacttgcc
acaccactgcaactagccaatgccacagcgatcatggccaaccacggcaaacaggtggtc
cccactctcgccggagacactaaaccagtagaacgtaccgatatcgtgcttaatgatcag
agcaactgggaaaaaatggccgacgccatggttggtgtaacccagctcggcggcacggcg
cgggccatggccgtgaaagccaaatatgacatcgctgctaaatccggcactgctcaggtt
ttctcggtgggccaggacgaaacctataatgaagaagaattgacggaacgactactggac
cacgccctactggtatcctttgcccccgccgacaagccagcgattgccgtggcggtgctg
gtggaaaatggccgccacggcggctctaccgcggggccggttgcccgcgaagtcatggat
gcgtggctactggatgaacagggggagctgaaagtaccgccggtgtttgccgaaaccccg
ccccatccaccgtccaataccaccatcaataatgccggtaacgagaaccgcccatga

DBGET integrated database retrieval system