KEGG   Alcanivorax sp. NBRC 101098: AS19_24910Help
Entry
AS19_24910        CDS       T03879                                 

Definition
(GenBank) alkyl hydroperoxide reductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
aln  Alcanivorax sp. NBRC 101098
Brite
KEGG Orthology (KO) [BR:aln00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AS19_24910
Enzymes [BR:aln01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     AS19_24910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA HI0933_like FAD_binding_2 FAD_oxidored DAO Thi4 NAD_binding_8 AlaDh_PNT_C Lycopene_cycl NAD_binding_7 FAD_binding_3 K_oxygenase 3HCDH_N Glutaredoxin Trp_halogenase
Motif
Other DBs
NCBI-ProteinID: BAP15342
LinkDB All DBs
Position
complement(2732880..2734496)
Genome map
AA seq 538 aa AA seqDB search
MLTNEILQALKGYAANMQKKVSFVLQSGSHDKREELVTFLSSIAGVSDNLAFEERDLGDR
LRSPISFLLEADGEDTGIRFSGIPAGHEFNSLVLAFLHASGTEIKLDAGLQRMVAKAKGD
MHFEVFISLSCHNCPDVVQALNQFALLNPNIRTEMIDGGLFQDVVSDRNIQGVPSVYLNG
ELFANGKVTAAELIDKLLAYDPSLAEAGVGEKLPLQDVTVIGGGPAGVSAAIYSARKGLK
VTLIADRIGGQVKDTMDIENLISVKKTTGPELSGALQAHMSEYDVTVKEHLRVARVEKGD
IKTVVLSSGEAIDTKTIIVATGAKWRELGVPGEKENIGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVNVFEFMPELKADKVLVDKAEAKANITIHRNVATNQIMASN
GKVDAIEYIDRDTEQLHRLPLHGVFVQIGLVPNSDFLEGVVERSRFGEIEINEKCQTSQE
GIYAAGDVTTVPYKQIVISMGEGSKASLAAFEYLLTQSDRLDALYENDKDVQKVAAVA
NT seq 1617 nt NT seq  +upstreamnt  +downstreamnt
atgctcacgaatgaaattttgcaggctcttaagggctacgccgccaacatgcagaagaaa
gtctcttttgtgctgcaaagcggatcccatgacaaacgcgaggaactggtaacgtttctt
tccagtatcgcgggtgtcagtgacaatctcgcgttcgaagaacgggatctgggtgacagg
ctccgtagtccaatcagttttctgttagaagccgatggtgaagacaccggtatccgtttc
tccggtattcccgcaggccatgaattcaattccttggtgttagcgtttctacatgcatct
gggaccgaaattaaactggacgcgggtcttcagcgcatggtggctaaggccaaaggcgac
atgcattttgaagtgtttattagcctgagctgccataactgcccagatgtggttcaggcg
ctgaatcagttcgccttgttgaaccccaatatccgtacggaaatgatcgacggggggttg
tttcaggatgtggtcagtgacaggaacattcagggtgtgcccagcgtttacttgaacggc
gagttgttcgccaatggcaaggttaccgccgctgagttgatcgataagctgttggcctac
gacccaagcctcgctgaagccggtgtcggagaaaaactgccattgcaggatgttaccgtt
atcgggggcggcccggcgggtgtttccgccgcaatttacagcgcccgtaaaggtttgaag
gtcaccctgatcgccgatcgtattggtgggcaggtgaaagacaccatggatatcgaaaac
ctgatctccgtaaagaaaaccaccggcccggaactgtctggtgcgctgcaggcgcatatg
agcgaatacgatgtgacagtaaaagagcatctgagagtggctcgtgtggagaaaggcgat
attaagaccgtggttttgtcttccggtgaagctatcgacaccaagacgattatcgtggcc
accggcgccaagtggcgcgaactgggtgtgcctggtgaaaaggaaaatatcggcaatggt
gtggcttactgcccacactgtgatggtcccttcttcaagggcaaggatgtcgctgtcatt
ggtggtggcaactctggcatcgaagctgcgctggatttggccggtatcgttaaatcagtg
aatgtattcgagttcatgccagagctgaaagcggacaaggtgctggtggacaaggctgaa
gccaaagccaacattaccattcacaggaacgtggcaaccaatcagataatggccagtaac
ggcaaggtagatgccattgaatacattgaccgtgatactgagcaattacatcgactgccc
ttgcatggggtgtttgtgcagatcggactggtgcccaacagtgactttctagaaggggtg
gttgagcgtagtcggtttggagaaattgaaatcaacgagaagtgccagacatcgcaagag
ggaatttatgcggctggtgatgtgaccaccgtgccgtacaaacagattgttattagtatg
ggcgaaggctctaaggcttccctggctgcttttgaatacctgctgacacagagcgatcgt
cttgatgccctgtatgaaaatgacaaggatgtgcagaaggtcgcagcggttgcctga

DBGET integrated database retrieval system