KEGG   Alloactinosynnema sp. L-07: CRK55904Help
Entry
CRK55904          CDS       T04489                                 

Definition
(GenBank) ATP-dependent DNA ligase LigC
Organism
alo  Alloactinosynnema sp. L-07
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: CRK55904
UniProt: A0A0H5CEJ6
LinkDB All DBs
Position
I:complement(888906..889991)
Genome map
AA seq 361 aa AA seqDB search
MALPLTPPVQPMLAKAVKSIPDDASLVFEPKWDGFRCLVFRDGDEVTLQSRSGKPLNRYF
PEAEIALRAALPERVVVDGELVVDIDGRLDFDKLAERIHPAASRVKMLSETTPSRFIAFD
VLALGDDLLLDTPGVERRRRLEDLLTVTDSVHLTPATTSSDLARQWFEIFEGAGLDGVMG
KPADGPYTPNKRTMLKFKHSRTADCVVAGLRWYKDTEPGEAVGSLMLGLYDNTGGLNHVG
VVGSFPAARRRELAVELADLMRDGAEDHPWAKWHEAEATRKPGAVSRWRTTEQPWVPLRL
ERVVEVAYEHTEGGYPSRFRHTAQFQRWRPDREPSSCTYEQLEEPARYDLASVLRGEVRA
R
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
gtggccctcccactgaccccgccggtccagccgatgctcgccaaggccgtcaagtccatc
ccggacgacgcgagcctggtgttcgagcccaaatgggacggtttccgctgcctggtgttc
cgcgacggcgacgaggtgacattgcagtcgcgctcgggtaagccgctcaaccgctacttc
cccgaggccgagatcgccctgcgcgcggcgctgccggagcgggtggtggtcgacggggaa
ctcgtcgtcgacatcgacggcaggctcgacttcgacaagctcgccgagcgcatccacccc
gccgcgagccgggtgaagatgctgtcggagaccaccccgtcgcgcttcatcgccttcgac
gtcctcgccctcggcgacgacctgctcctcgacacccccggcgtcgagcggcggcgcagg
cttgaggacctgctgacggtgaccgactcggtgcacctcaccccggccacgaccagctcc
gacctggcccgccagtggttcgagatattcgagggcgcgggcctcgacggcgtcatgggc
aagcccgccgacggcccgtacacgccgaacaagcgcacgatgctcaagttcaagcactcg
cgcaccgcggactgcgtggtggcgggcctgcgctggtacaaggacaccgagcccggcgag
gcggtcggctcgctgatgctcggcctctacgacaacaccggcggcctcaaccacgtcggc
gtcgtcggctcgttccccgccgcccgccgccgcgaactcgccgtcgaactcgccgacctg
atgcgcgacggcgccgaggaccacccgtgggcgaagtggcacgaggccgaggcgacgcgc
aagccgggcgcggtcagccggtggcgcacgaccgagcagccctgggtcccgctgcggctg
gaacgggtcgtggaggtcgcctacgagcacaccgaaggcggctatccgagccgcttccgg
cacaccgcccagttccagcgctggcgcccggaccgcgagccttcgtcctgcacgtatgag
cagctggaggaaccggcccgctacgacctggcctcagtcctaagaggcgaggtccgcgcc
cgctag

DBGET integrated database retrieval system