KEGG   Alloactinosynnema sp. L-07: CRK56894Help
Entry
CRK56894          CDS       T04489                                 

Definition
(GenBank) ATP-dependent DNA ligase clustered with Ku protein, LigD
Organism
alo  Alloactinosynnema sp. L-07
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase
Motif
Other DBs
NCBI-ProteinID: CRK56894
UniProt: A0A0H5CHF2
LinkDB All DBs
Position
I:1976742..1977677
Genome map
AA seq 311 aa AA seqDB search
MAVLGPPVGLALARSLGRLPAPDPARLALEPKFDGWRGALFAMAGVLQSRRDNDLAARFP
EIIRAGAGLGDVVLDGEIVALREGRLDFGSLTVAPARRADLGVVIYYVAFDVLAVGEDDL
RVLPYGDRRARLEELFAGAAPPLQLAPSVRGMAEALAWMEPEQAVVGIEGVIIKDVRRPY
RPGRTGDWLKVRQTRLVDAVVIGVTGSLARPLELVLARPDESGERRWIGLSQPLPPKLRD
QAGQHVRSTGESPRRVSGGGFGQPSTEYLPVHADPGGRGPGRGERAELHLPAPPARASAP
PRPDPTVEDLG
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcggtgctcgggcccccggtggggttggccctggctcgctcgcttgggcggctgcct
gcgcctgacccggcgcggctggcactcgaaccaaaattcgatggctggcgcggggctcta
ttcgcgatggcgggggtgctgcagtcgcgccgggacaacgatctcgcggcgcggttcccg
gagatcatccgcgcgggggctgggctgggagacgtcgtgctcgacggggagatcgtcgcc
ctgcgcgagggccggttggacttcggatcgctcaccgtggccccggcccggcgagcggac
ttgggcgtggtgatctactacgtcgccttcgacgtgctcgccgtcggcgaggacgatctg
cgcgtcctgccctacggcgaccgccgcgcccgactggaggaactgttcgccggggccgct
ccgccgttgcagctggccccgagcgtgcgcggcatggccgaggctctggcgtggatggag
cccgagcaggcggtcgtcggtatcgagggcgtgatcatcaaggatgtgcgccgcccgtat
cggcccggtcggaccggggactggctgaaggtgcggcagacgaggctggtcgacgcggtg
gtgatcggtgtgacgggctcgctcgcgcgtcctctggagttggtgctcgcccgccctgat
gagagcggcgagcggcggtggatcggactgtcgcagccgttgccgccgaagctgcgcgat
caggccggacagcatgtgaggtcgacgggggaatcgccgcggcgggtgtccggcggcgga
ttcggccagccgagcaccgagtacctgccggtccacgccgaccctggtggtcgaggtcca
ggccgaggcgagcgtgcagaacttcacctcccggctccgcccgcgcgtgcatcggctccg
ccccgccccgacccgaccgtcgaggatctcggttga

DBGET integrated database retrieval system