KEGG   Alloactinosynnema sp. L-07: CRK58719Help
Entry
CRK58719          CDS       T04489                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
alo  Alloactinosynnema sp. L-07
Pathway
alo00473  D-Alanine metabolism
alo00550  Peptidoglycan biosynthesis
alo01100  Metabolic pathways
alo01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:alo00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CRK58719
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CRK58719
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CRK58719
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:alo01011]
    CRK58719
Enzymes [BR:alo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CRK58719
Peptidoglycan biosynthesis and degradation proteins [BR:alo01011]
 Precursor biosynthesis
  Amino acid ligase
   CRK58719
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_3 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: CRK58719
UniProt: A0A0H5CME5
LinkDB All DBs
Position
I:complement(3927257..3928348)
Genome map
AA seq 363 aa AA seqDB search
MSSSKIRVAVVFGGRSTEHPVSCVSAASVLANLDQDRFEVVPVGITKDGSWVLGPSDPEV
LRIHDRTLPSITSGTSVTLPADPTAGRLVILEKGHEGRIFSAVDVVIPMLHGAYGEDGTI
QGLLEMAGLPYVGPGVMSSAVAMDKGVTKKLLKAEGLPVGPYVELRRDQTTLDAAERDRL
GLPVFVKPSRAGSSTGITRVTDWAQLDAAIVHAREIDPKVLIEGAIVGREVECGVLEFPD
GRVEASQPAEVRLLGDLDWYDFDSKYLDDTSELEIPAKLPDEVTERLRNMAVDAFRALDC
QGLARVDFFVGEGGTLTINEVNTMPGFTPTSAYPKMWDVTGVDYPTLLTVLIDTAIARGT
GLR
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagctcaaagatccgagtcgccgtggtgttcggcggacgcagcacggaacacccc
gtgtcctgtgtctccgccgcgagcgtgctcgccaacctggaccaggaccggttcgaggtg
gtgcccgtcggcatcaccaaggacggctcctgggtgctcggccccagcgaccccgaggtc
ctgcgcatccacgaccgcacgctgcccagcatcacctccggcacttcggtcaccctgccc
gccgacccgaccgcgggccgcctggtcatcttggagaagggccacgagggccggatcttc
tccgcggtcgacgtcgtcatcccgatgctgcacggcgcctacggcgaggacggcaccatc
cagggtctgctggagatggcggggctgccctatgtcggaccgggcgtgatgtccagcgcc
gtcgcgatggacaagggcgtcaccaagaagctcctcaaggccgagggcctgccggtcggc
ccgtacgtggaactccgccgcgaccagacgacactcgacgccgccgagcgcgaccgcctc
ggcctgccggtgttcgtcaagccgtcgcgcgcgggctcgtccaccggcatcaccagggtc
accgactgggcccagctcgacgccgcgatcgtgcacgcccgcgagatcgacccgaaggtg
ctgatcgagggcgccatcgtcggccgcgaggtcgagtgcggcgtgctggagttccccgac
ggccgggtcgaggcctcgcagcccgccgaggtgcgcctgctcggcgacctggactggtac
gacttcgactccaagtacctcgacgacaccagcgagctcgagatcccggccaagctgccc
gacgaggtcaccgagcgcctgcggaacatggcggtcgacgcgttccgcgcgctcgactgc
cagggcctcgcgcgcgtcgacttcttcgtcggcgagggcggcacgctgacaatcaacgag
gtcaacaccatgccgggcttcaccccgacctcggcctacccgaagatgtgggacgtcacc
ggcgtcgactacccgaccctgctgaccgtcctcatcgacacggcgatcgcgcgcggcacg
ggactccgctga

DBGET integrated database retrieval system