KEGG   Alloactinosynnema sp. L-07: CRK58896Help
Entry
CRK58896          CDS       T04489                                 

Definition
(GenBank) Aspartyl-tRNA(Asn) amidotransferase subunit A @ Glutamyl-tRNA(Gln) amidotransferase subunit A
  KO
K02433  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit A [EC:6.3.5.6 6.3.5.7]
Organism
alo  Alloactinosynnema sp. L-07
Pathway
alo00970  Aminoacyl-tRNA biosynthesis
alo01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alo00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CRK58896
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:alo03029]
    CRK58896
Enzymes [BR:alo01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CRK58896
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CRK58896
Mitochondrial biogenesis [BR:alo03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CRK58896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Amidase
Motif
Other DBs
NCBI-ProteinID: CRK58896
UniProt: A0A0H5CMB6
LinkDB All DBs
Position
I:complement(4107307..4108824)
Genome map
AA seq 505 aa AA seqDB search
MTDLIRLTAAELAAKIQAKDVSAVEVAQAHLDRIAAVDGAVNAFLHVDGERALNAARAVD
EDIAAGNPAASPLAGVPLALKDVLTMRGAPTTCGSKMLEGWQPPYDATVTLKLLEAGVVI
LGKTNMDEFAMGSSTENSAYGVTRNPWDLDRIPGGSGGGSSAALASFEAPLAIGTDTGGS
IRQPGSVTGTVGVKPTYGTVSRYGLVAFSSSLDQAGPCARTVLDAALLHEVIGGHDPLDS
TSIDAPLPPVVAAAREGAKGDLSGVRVGVVTQFAGDGYQAGVLASFEAAVAQLKELGAEI
VEVSCPSFDLALPAYYLIAPSECSSNLARFDAMRYGLRVGDDAARSAEEVMSLTREAGFG
PEVKRRIMLGTYALSSGYYDAYYGSAQKVRTLITRDFDAAFGTVDVLVSPTTPTTAFRIG
ERANDPMAMYKADLCTIPSNLAGNAALSVPSGLSDEDGLPVGLQIMSPALHDHRGYKVAA
AYEAARNAAQGGPLINRVPELEVAH
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacctgatccgcctgaccgcggccgagctggccgcgaagatccaggccaaggac
gtctccgccgtcgaggtcgcccaggcccacctcgaccgcatcgccgccgtcgacggcgcc
gtcaacgcgttcctgcacgtcgacggtgagcgggcgctcaacgccgccagggccgtcgac
gaggacatcgcggcgggcaatccggccgcgtcgccgctggccggggtgccgctggcactc
aaggacgtcctgaccatgcggggcgcgccgaccacgtgcggctcgaagatgctcgagggc
tggcagccgccgtacgacgcgaccgtcacgctcaagctgctcgaagcgggcgtggtgatc
ctcggcaagaccaacatggacgagttcgcgatgggctcctccaccgagaactccgcctac
ggcgtcacccgcaacccgtgggacctcgaccgcatccccggcggctccggcggcggctcg
tcggccgcgctggcctccttcgaggcgcccctggcgatcggcaccgacaccggcggctcg
atccgccagcccggctccgtgaccggcaccgtgggcgtcaagcccacctacggcacggtc
tcgcgatacggcctggtcgccttctcctcctcgctcgaccaggcgggcccctgtgcccgc
acggtcctcgacgcggcgctgctgcacgaggtgatcggcgggcacgacccgcttgactcc
acctcgatcgacgcgcccctgccgcccgtggtcgccgcggcccgcgagggcgccaagggc
gacctgagcggtgtccgggtcggcgtggtcacccagttcgcgggcgacggctaccaggcg
ggcgtgctggcctccttcgaggccgcggtcgcccagctcaaggaactcggcgccgagatc
gtcgaggtgtcctgcccgagtttcgacctggcgctgcccgcctactacctgatcgcgccg
agcgagtgctcgtcgaacctcgcccggttcgacgccatgcgctacggcctgcgggtgggc
gacgacgccgcgcgcagcgccgaggaggtcatgtcgctgacccgcgaggcgggcttcggc
cccgaggtgaagcgccggatcatgctcggcacctacgcgctgtcgtcgggctactacgac
gcgtactacggctcggcgcagaaggtccggacgctcatcacccgcgacttcgacgccgcg
ttcggcacggtcgacgtcctggtctcgccgaccacgccgaccacggcgttccgcatcggc
gagcgggccaacgacccgatggcgatgtacaaggccgacctgtgcacgatcccgtcgaac
ctggcgggcaacgcggccctgagtgtcccgagtggactgtccgatgaggatggtctgccg
gtggggctgcagatcatgtccccggcactgcatgaccaccgcggctacaaggtggcggcc
gcgtacgaggccgcccgcaacgccgcgcagggtggtccgctgatcaaccgggttcccgag
ctggaggtggcgcactga

DBGET integrated database retrieval system