KEGG   Alloactinosynnema sp. L-07: CRK59673Help
Entry
CRK59673          CDS       T04489                                 

Definition
(GenBank) Nickel-dependent superoxide dismutase
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
alo  Alloactinosynnema sp. L-07
Brite
KEGG Orthology (KO) [BR:alo00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    CRK59673
Enzymes [BR:alo01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     CRK59673
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: CRK59673
UniProt: A0A0H5CPL7
LinkDB All DBs
Position
I:4873617..4874024
Genome map
AA seq 135 aa AA seqDB search
MRLLSRVFAPRLEATAHCDLPCGVYDPAQARIEAESVLAVQKKYQDNEDPQFRARAIRIS
EDRSELVKHHLWVLWTDYFKAPHFEKYPDLHDLFNRATKAAGAGGTKGSMDPATGQALLD
LIGEIDKIFWETKKA
NT seq 408 nt NT seq  +upstreamnt  +downstreamnt
atgcgactgctgtcgcgcgtcttcgcgcctcgcctggaggccaccgcccactgtgacctt
ccctgcggcgtgtacgacccggcccaggcccgcatcgaggccgagtccgtgctggcggtc
cagaagaagtaccaggacaacgaggacccccagttccgcgcccgcgcgatccgtatctcc
gaggaccgcagcgagctcgtcaagcaccacctgtgggttctctggaccgactacttcaag
gccccgcacttcgagaagtacccggacctgcacgacctgttcaaccgcgccaccaaggcc
gcgggcgcgggtggcaccaagggttcgatggacccggccaccggccaggccctgctcgac
ctgatcggcgagatcgacaagattttctgggagaccaagaaggcgtaa

DBGET integrated database retrieval system