KEGG   Arcobacter sp. LPB0137: LPB137_00180Help
Entry
LPB137_00180      CDS       T04722                                 

Definition
(GenBank) arginine kinase
  KO
K00933  creatine kinase [EC:2.7.3.2]
Organism
alp  Arcobacter sp. LPB0137
Pathway
alp00330  Arginine and proline metabolism
alp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alp00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    LPB137_00180
Enzymes [BR:alp01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.3  Phosphotransferases with a nitrogenous group as acceptor
    2.7.3.2  creatine kinase
     LPB137_00180
Exosome [BR:alp04147]
 Exosomal proteins
  Exosomal proteins of epithelial cells
   LPB137_00180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-gua_Ptrans ATP-gua_PtransN BAG MtrG
Motif
Other DBs
NCBI-ProteinID: APW64356
UniProt: A0A1P8KII2
LinkDB All DBs
Position
complement(37742..38791)
Genome map
AA seq 349 aa AA seqDB search
MSDTNEYPHFPSDCKSLLSKYLTKEVYTQLKDKTTPSGFTLDEAIASGVQNSDSGIGVYA
GDIESYTTFSALFDPIIEEYHGFSKTDSHISNLNPNDLKAPNPDPENKYIVSTRIRVGRN
IANLPLGPAISNEQRDNVENQVSQALNALEGSLKGKYYPLDGMSEEISQKLISDHFLFKA
GDRFLEAAGLNRNWPKGRGIYHNDEKTFLVWVNEEDQLRIISMQKGGDIKEVFQRLTDAI
SKIEEKIEFSYSEHLGYITSCPTNLGTAMRASVHIKVPNLSKDYTRFEEITNKYHLQIRG
INGEHSQSVGGIYDISNKRRLGVTEVQCVQDMYDGVVQLIKREKELEAK
NT seq 1050 nt NT seq  +upstreamnt  +downstreamnt
atgtctgatacaaatgaatatccacactttccaagtgattgtaaatctttattatcaaag
taccttacaaaagaagtttatacacaactaaaagataaaactacaccttcaggttttact
cttgatgaagcaattgcttcaggagttcaaaatagtgatagtggaattggtgtttatgca
ggagatattgaatcttacacaactttttcagcactttttgacccaattatagaagaatat
catggtttttctaaaactgattctcatattagtaatttaaacccaaatgatttaaaagca
ccaaatccagatccagaaaataaatatattgtttctacaagaattagagtaggaaggaat
attgcaaaccttcctttaggacctgctatttcaaatgagcaaagagataatgtagaaaac
caagtatcacaagctttaaatgcattagaaggtagtttaaaaggaaaatactatccacta
gatggaatgagtgaagaaatatcacaaaagctaattagtgaccattttttatttaaagca
ggggatagatttttagaagcagcaggacttaatagaaattggccaaaaggtagaggtatt
taccataatgatgaaaaaacttttttagtatgggttaatgaagaagaccaattaagaata
atctctatgcaaaaaggtggagatattaaagaagtattccaaagactaacagatgctatt
tcaaaaattgaagaaaaaattgaattctcatatagtgagcacttaggatatattacatct
tgtcctacaaatcttggaacggcaatgagagctagtgttcatataaaagtaccaaattta
agtaaagactatacaagatttgaagaaattacaaataaatatcacttacaaattagagga
ataaacggtgaacactctcaaagtgttggtggaatttacgatataagtaataaaagaaga
ttaggagtaacagaagtacaatgtgttcaagacatgtacgatggtgttgttcaactaatt
aaaagagaaaaagagttagaagctaaatag

DBGET integrated database retrieval system