KEGG   Alloprevotella sp. E39: C7Y71_001735
Entry
C7Y71_001735      CDS       T06230                                 

Gene name
galK
Definition
(GenBank) galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
alq  Alloprevotella sp. E39
Pathway
alq00052  Galactose metabolism
alq00520  Amino sugar and nucleotide sugar metabolism
alq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    C7Y71_001735 (galK)
   00520 Amino sugar and nucleotide sugar metabolism
    C7Y71_001735 (galK)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:alq04147]
    C7Y71_001735 (galK)
Enzymes [BR:alq01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     C7Y71_001735 (galK)
Exosome [BR:alq04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   C7Y71_001735 (galK)
SSDB
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_N GHMP_kinases_C HHH_2
Other DBs
NCBI-ProteinID: QFQ11842
UniProt: A0A5P8E4F3
LinkDB
Position
404769..405929
AA seq 386 aa
MKLTIEDVRSRFIKHFDGQTGSVYTAPGRINLIGEHTDYNNGYVFPGAVEQGMIAEIKPN
GTRNVDAYSIDLKDRVQFSLDDEKGPNATWARYIYGVCREMMALGVPVEGFNTAFAGDVP
LGAGMSSSAALESTYAFAINDLFGENKIERMELALVGQRTEHKYIGVNCGIMDQAISCLG
KAGHLMRMDCRSGEIEYFPWHPKGYQLVLVNSCVKHELKGSPYNERRLQCEHVAEVIAKK
HPEVESLRDATMEMLDEVKNEITGAEYKRARYVIGEVVRVLAVCEALEIDDYEKVGQMMY
DTHYGLSKEYEVSCEELDFLNDVAKECGVTGSRIMGGGFGGCTINLVADELAPNFKKVVV
EKFEEKYGKKPIVIDVVIGDGARKLC
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaaattaacaatcgaagacgttcgcagtcgttttatcaagcatttcgacggtcagact
ggctctgtttataccgctcccggtagaattaacctcattggtgagcacactgactataac
aacggttatgtattccctggcgccgtagaacaaggaatgattgccgagattaaacctaat
ggcactcgcaacgttgatgcctacagcattgacctcaaggatcgtgttcagttctcactc
gatgacgagaaagggcctaatgccacttgggcacgctatatctatggtgtttgccgcgaa
atgatggctcttggtgttcccgtagaaggtttcaacacagcctttgccggtgacgtacct
ctcggagcaggtatgagtagttctgcagcccttgaaagcacttacgcttttgctatcaat
gatctcttcggcgagaacaagattgagcgcatggaactggcgcttgtaggtcagcgcaca
gaacacaagtacatcggtgtaaactgtggtattatggaccaggcgatttcttgcctcggt
aaggccggtcatcttatgcgtatggactgccgcagcggtgagatagagtatttcccctgg
catccaaaaggctaccaactcgtactcgtaaatagttgcgtgaagcacgaactcaagggt
tctccttataatgagcgccgcctgcaatgcgaacacgttgcagaggtgattgccaaaaaa
catcctgaagttgagagtcttcgcgatgcaacgatggagatgcttgacgaagtgaaaaac
gaaatcacaggtgcagaatacaagcgcgcacgctacgtcatcggtgaggtagttcgcgtt
cttgcagtctgcgaagccctcgaaatcgatgactacgagaaggtaggtcagatgatgtac
gacacccactatggtctcagcaaggaatacgaggttagttgcgaagaactcgacttcctt
aacgatgtggctaaggagtgcggtgtaacaggttcacgcatcatgggcggcggctttggt
ggttgcaccatcaacctcgttgctgacgaactggctcctaacttcaagaaggttgtagta
gaaaaattcgaagagaagtacggcaagaagcctatcgtcattgacgttgtcattggtgat
ggtgcccgcaaactctgctaa

DBGET integrated database retrieval system