KEGG   Alteromonas sp. RKMC-009: DS731_09230Help
Entry
DS731_09230       CDS       T05653                                 

Gene name
ahpF
Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
alr  Alteromonas sp. RKMC-009
Brite
KEGG Orthology (KO) [BR:alr00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    DS731_09230 (ahpF)
Enzymes [BR:alr01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     DS731_09230 (ahpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox Thioredoxin_3 GIDA FAD_binding_2 HI0933_like DAO FAD_oxidored Thi4 AlaDh_PNT_C Lycopene_cycl NAD_binding_8 NAD_binding_7 FAD_binding_3 Thioredoxin_9 K_oxygenase 3HCDH_N DUF4891 Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AYA64156
UniProt: A0A385MUL5
LinkDB All DBs
Position
2089567..2091150
Genome map
AA seq 527 aa AA seqDB search
MLTKEILQALKGYTASMQKEVTFVVQTGEHSKRGELVEFLSGVASVSDNIKLEERDTNGV
LRSATSFLLEADGEDTGIRFSGIPGGHEFNSLILAILHASGTALKVDDNLQNIVKGVNEP
LHFEVFISLSCHNCPDVVQALNQFALLNPNITSEMIDGGVYPKLIEERDIQGVPSVYLNG
ELFANGKVDASTLLDKLLERDPSLKEANKGKSMPLQDVTVIGGGPAGVSAAIYSARKGLN
VTIVADRFGGQVKDTMGIENLISVPKTTGPELVGNLMEHMKDYDITLKEHVKVENIERGD
IKIVALSSGEEIRTRSIIVATGARWRELGVPGEKENVGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPTLKADDVLVKQAEKRDNITILRNVATNQIVAEN
GKVTAIEYTNRETQEVTTLPLAGVFVQIGLVPNSQFMQGVVDMTKHGEIIVDNKCITSEK
GIFAAGDVTTVPYKQIVISMGEGAKASLSAFEYLLTHEVPANEQADA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactaaagaaattttacaggcattgaaaggctacaccgcgtcaatgcagaaagaa
gtaacattcgttgtccagactggcgagcacagcaagcgtggcgaattggttgaatttctg
tctggcgtagcaagtgtaagcgacaacattaagttggaagagcgtgatacaaatggcgtt
ttacgcagcgcgacaagcttcttacttgaagctgacggtgaagataccggtattcgtttc
tccggcatcccgggtggacacgagtttaactcgttaatcctggcaattttacacgcgtca
ggcacagcgctgaaagtagacgacaatctgcaaaacatcgttaaaggtgtcaacgagccg
ctgcactttgaagtgttcatcagcttaagttgccataactgtcctgatgtcgtgcaggcg
ctgaatcagtttgcattgttaaaccctaacatcacatctgaaatgattgatggcggtgtt
tatccgaaactgattgaagaaagagacattcagggtgtaccgagtgtttacttaaacggc
gaattattcgctaacggcaaggtagatgcgtctactctgcttgataaactgttagagcgc
gacccgtcgctgaaagaagcgaacaagggcaagagcatgccgctgcaggacgtaaccgtg
attggtggtggtccggcaggtgtgagtgccgcaatctacagtgcacggaaaggcttaaac
gtgaccatcgtggccgaccgtttcggtggccaggtaaaagataccatgggtatcgaaaac
ttaatctcagtgccgaaaaccacaggacccgaactggtgggcaacctgatggagcacatg
aaagattatgacatcacgttgaaagagcacgtgaaagtcgaaaacattgaacgtggcgac
attaaaatcgtggcgttgtcatccggcgaagaaattcgtacccgctctatcattgtggct
acaggtgcccgctggagagaactgggtgtaccgggtgagaaagaaaacgtaggtaatggc
gtggcatactgtccgcactgtgatggtcctttctttaaaggcaaagacgtagctgttatc
ggcgggggtaactcaggcatcgaggctgctcttgacttggcgggtatcgtgaagtctgtc
accgtgttcgagtttatgccaacgctgaaagctgatgatgttctggttaagcaggctgaa
aagcgtgacaacattaccattctgcgcaatgtagcaacgaatcagattgtggcagaaaat
ggcaaagtaacggccattgagtacaccaaccgcgaaacgcaggaagtgaccacgttaccg
ctggcaggtgtgttcgtccagattggtctggtaccgaacagtcagttcatgcaaggtgtc
gtggatatgaccaaacacggtgaaatcatcgttgataataagtgtattacttctgagaaa
ggcatttttgcagccggcgacgtcaccaccgtgccgtacaagcagattgtcatctcaatg
ggtgagggcgcaaaagcatcattgtctgcctttgaatacctgttgactcacgaagtccct
gcaaacgaacaggcagatgcataa

DBGET integrated database retrieval system