KEGG   Alteromonas sp. RKMC-009: DS731_09705Help
Entry
DS731_09705       CDS       T05653                                 

Definition
(GenBank) D-alanyl-D-alanine carboxypeptidase
  KO
K07258  serine-type D-Ala-D-Ala carboxypeptidase (penicillin-binding protein 5/6) [EC:3.4.16.4]
Organism
alr  Alteromonas sp. RKMC-009
Pathway
alr00550  Peptidoglycan biosynthesis
alr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    DS731_09705
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:alr01002]
    DS731_09705
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:alr01011]
    DS731_09705
Enzymes [BR:alr01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     DS731_09705
Peptidases and inhibitors [BR:alr01002]
 Serine peptidases
  Family S11: D-Ala-D-Ala carboxypeptidase A family
   DS731_09705
Peptidoglycan biosynthesis and degradation proteins [BR:alr01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   DS731_09705
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S11 PBP5_C Beta-lactamase2 Beta-lactamase Peptidase_S13
Motif
Other DBs
NCBI-ProteinID: AYA64246
UniProt: A0A385MUT3
LinkDB All DBs
Position
complement(2196326..2197510)
Genome map
AA seq 394 aa AA seqDB search
MHKIINRAKPSFMLTMFIMMCMSYVAKVHANVVIPPPPSVAAEGFVLMDNETGQVIAEKN
ADMQLPPASLTKMMTTYVIGKELEAGNISMDDEVTISENAWAKNFPESSKMFIEVGTQVK
VADLVRGIIIQSGNDACVAMAEHIAGSESAFASMMNAHAQALGMSSSHFVNSHGLHDPDH
YVTPRDMALLSQALVAETPEIYAIYSEKEYTYNGIKQYNRNSLLWDQSLNVDGIKTGHTS
DAGYSLITSAKQGDMRLISVVMGTDSERARKEENKKLLRYGFRFYETVTPYKAGESFVAH
RIYMGDRETVDLGINQSTPITIPRGQAGNLEASFELDKKLEAPLAKGQVVGTLYLQLDGE
DVANYPLVALQEVNEGGFFDRMVDYVMLQLGWDE
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgcataaaattataaatcgcgctaaaccgtctttcatgctcaccatgtttatcatgatg
tgcatgtcttatgttgccaaagtccacgccaacgtcgtgatcccgccgccgccaagtgtt
gccgctgaaggcttcgtgctgatggataacgaaacgggccaggttatcgcagagaaaaat
gcagacatgcagttgccgcctgcaagtctgactaaaatgatgacgacgtatgtcatcgga
aaagagctggaagccggcaatatcagcatggacgatgaagtaaccatttctgaaaatgca
tgggcgaagaattttccggaatcatcaaaaatgttcattgaggtgggtacacaggtaaaa
gtggccgacctggttcgcggtattattattcagtccggtaacgatgcctgtgttgctatg
gctgaacatatcgccggttctgaaagtgcctttgccagcatgatgaatgcccacgcgcag
gcgctgggtatgtcttcttcacattttgtgaacagccacggcctgcacgaccccgatcac
tacgtaacgccgcgggatatggcgctgttgtctcaggcgctggtcgctgagacgccggaa
atctacgcgatttacagcgaaaaagagtacacctacaacggtatcaaacagtacaaccgt
aacagcttgctgtgggatcagagcctgaatgtggatggcattaaaaccggtcacacttct
gatgcaggctacagcctcatcacctcggccaaacaaggtgatatgcgtttaatttctgtt
gtgatgggcacagacagtgaacgcgcccgaaaagaagaaaacaaaaaattattgcgttac
ggtttccgtttctatgaaactgtaaccccttataaagccggtgaaagcttcgttgctcac
cgcatttatatgggtgaccgcgaaactgtagaccttggaattaatcaatctacccccatt
accattccccgtggccaggcaggtaacctggaagccagctttgagttagataagaaactg
gaagcgccactggcaaaaggccaggtggtcggcacactttacctgcaactggacggcgaa
gacgttgccaactatccccttgttgctttgcaggaagtgaatgaaggtggtttcttcgat
cgtatggttgattatgtcatgctgcagcttggctgggacgaataa

DBGET integrated database retrieval system