KEGG   Arcticibacterium luteifluviistationis: DJ013_06905Help
Entry
DJ013_06905       CDS       T05496                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
als  Arcticibacterium luteifluviistationis
Pathway
als00010  Glycolysis / Gluconeogenesis
als00030  Pentose phosphate pathway
als00051  Fructose and mannose metabolism
als00052  Galactose metabolism
als00680  Methane metabolism
als01100  Metabolic pathways
als01110  Biosynthesis of secondary metabolites
als01120  Microbial metabolism in diverse environments
als01130  Biosynthesis of antibiotics
als01200  Carbon metabolism
als01230  Biosynthesis of amino acids
als03018  RNA degradation
Module
als_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:als00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DJ013_06905 (pfkA)
   00030 Pentose phosphate pathway
    DJ013_06905 (pfkA)
   00051 Fructose and mannose metabolism
    DJ013_06905 (pfkA)
   00052 Galactose metabolism
    DJ013_06905 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    DJ013_06905 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    DJ013_06905 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:als01009]
    DJ013_06905 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:als03019]
    DJ013_06905 (pfkA)
Enzymes [BR:als01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     DJ013_06905 (pfkA)
Protein phosphatases and associated proteins [BR:als01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     DJ013_06905 (pfkA)
Messenger RNA biogenesis [BR:als03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     DJ013_06905 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase
Motif
Other DBs
NCBI-ProteinID: AWV97910
UniProt: A0A2Z4G9Z2
LinkDB All DBs
Position
1636024..1636998
Genome map
AA seq 324 aa AA seqDB search
MKKVAIFTSGGDAPGMNACIRAVVRGGIYHGLDMYGIVRGYSGMISGDIKKMDSRSVSNI
VQRGGTILKSARSMEFMTPEGRKKAYDTLMSHGIDGLIAIGGNGTFTGAEVFFNEYQIPT
VGCPGTIDNDLYGTDYTIGFDTAVNTSLEAIDKIRDTADSHDRVFFIEVMGRDSGYIAIQ
SGIGGGAEIVMVPETHTPLKKVITTLKDGWKRSKSSSIVVVAEGDEEGHAPEIAEKIKKQ
VGDKLDIRVTTLGHIQRGGGPTAYDRILASRLGLGAIEGLINGEKNVMAGIVNNNLVFTP
FIDTIQKPKPIHEDLLRMVHILSI
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagtagcaatttttacgtcgggtggcgatgccccagggatgaacgcttgtata
agagcagtagtgagaggtggtatttaccatggtttggatatgtatggtatagtacgggga
tattcaggaatgatctcaggcgatattaaaaagatggattcacgttctgtaagtaacatt
gtacagcgtggaggaacgatattaaaatcggctagaagcatggagtttatgactcctgag
ggcagaaagaaggcttatgatacattgatgtctcatggtatcgatggtcttatcgcaatt
ggtggaaatggtacatttacaggagcagaggtgttttttaacgaatatcaaattccaacg
gtaggttgtcctggtactattgataatgatttatatggaactgactatactataggtttt
gatacagcggttaatacctctttagaagccattgataaaattagagatactgcagattct
cacgatagagttttctttattgaggtgatgggtagagactctggatatatagctattcag
tcgggtattggtggtggagcggaaatcgttatggttccagaaacacatacaccacttaag
aaagtgattactactcttaaggatggatggaagcgttctaaatcttcttctatagtagtg
gtagcagaaggtgacgaagaaggccatgctccagaaatagctgaaaaaatcaaaaaacaa
gtaggagataagcttgatatacgtgtaactacactaggacacattcagcgtggtggagga
cctacggcttatgatagaattttggcaagtagattaggccttggagctatcgaaggttta
attaacggtgaaaagaacgtgatggcgggaatagtaaataataatttagtgtttactcct
tttattgatactattcagaaaccaaagcctattcatgaagacttacttagaatggtacat
attcttagtatttaa

DBGET integrated database retrieval system