KEGG   Alteromonas naphthalenivorans: ambt_01990Help
Entry
ambt_01990        CDS       T01513                                 

Definition
(GenBank) putative glutathione S-transferase protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    ambt_01990
Enzymes [BR:alt01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     ambt_01990
Transporters [BR:alt02000]
 Other Transporters
  Pores ion channels [TC:1]
   ambt_01990
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N GST_N_3 GST_N_2 GST_C GST_C_3 GST_C_2
Motif
Other DBs
NCBI-ProteinID: AEF01952
UniProt: F5ZAI2
LinkDB All DBs
Position
466470..467108
Genome map
AA seq 212 aa AA seqDB search
MYTLYGYPKTRSVRVAWALEEIGLPYEYKVVNLKAGEHLNSAFKTLNPATKIPVLVTEQG
ALSESGAIVTFLAEKHAMEEFIPASGTFERGLYEQMMIFAVSELEQPLWSKAKHTFALPE
QHRIPQMQNTAAWEFDRALTAFSLLLNDKEYVCGSLFTMADIVTAQVLSWAKGSELDLKF
DNVKSYAERVLSRSAYEKAWRNEVAHLAKADA
NT seq 639 nt NT seq  +upstreamnt  +downstreamnt
atgtatacactttatggatacccgaaaacgcggtcggtaagggtggcatgggctttagaa
gaaattggcttaccttacgagtacaaggtggtgaatttaaaagccggtgaacacttaaac
tcagcatttaaaacacttaatccggccactaaaattcctgtattagtcactgaacaaggt
gccctttctgagtcaggtgccatagtgaccttcttagcagaaaagcatgcaatggaagag
tttattcctgcatcaggtacatttgaacgtgggttgtatgagcaaatgatgatatttgcc
gttagcgaactagagcagcccttatggagtaaagcaaagcatacctttgctttacctgag
cagcatcgtattccccagatgcaaaacacagcagcgtgggaatttgatcgagcgttaaca
gcgttctcgctacttcttaatgacaaagagtatgtgtgcggcagtttgttcacaatggcc
gacatcgtgacagcccaagtgttgtcatgggcaaaaggcagtgagctagacctaaagttc
gacaatgtaaagtcatatgctgaacgggtgttgtctcgctcggcctatgaaaaagcatgg
cgcaatgaagttgcgcatttggctaaggcggatgcttaa

DBGET integrated database retrieval system