KEGG   Alteromonas naphthalenivorans: ambt_06765Help
Entry
ambt_06765        CDS       T01513                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
alt  Alteromonas naphthalenivorans
Brite
KEGG Orthology (KO) [BR:alt00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    ambt_06765
Enzymes [BR:alt01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     ambt_06765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like Thioredoxin_3 FAD_binding_2 GIDA DAO Thi4 Lycopene_cycl FAD_oxidored NAD_binding_8 NAD_binding_7 AlaDh_PNT_C K_oxygenase Thioredoxin_9 FAD_binding_3 3HCDH_N Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AEF02888
UniProt: F5Z4E8
LinkDB All DBs
Position
1524706..1526295
Genome map
AA seq 529 aa AA seqDB search
MLTKEILQALKGYAESMQKNVTFVVQTGEHSKREELVSFLSDIAGVSDKLSLEERDTKGV
LRSSISFLLEADGEDTGIRFSGIPGGHEFNSLILGMLHASGTELKIDDSVKAIVKGVKEE
LNFEVFISLSCHNCPEVVQALNQFALLNPNITSEMIDGGLYQNVVAERDIQGVPSVYLNG
ELFANGKVDASVLIDKLIERDPSLKEANKGESLPLQDVTVIGGGPAGVASAIYSARKGLK
VTVVADRFGGQVKDTMGIENLISVSKTTGPELVGNLMEHMNDYDITLKEHVRVDSVEQGN
VKTITLSSGEQIRTRSIIVATGARWRELGVPGEKENVGNGVAYCPHCDGPFFKGKDVAVI
GGGNSGIEAALDLAGIVKSVTVFEFMPELKADQVLIDQAEKRENITIIRNAATHQITAEN
GKVNAIEYQDRNTTELHTLPLSGVFVQIGLVPNSQFMEGVVDMSKYGEIVIDTKCNTSAP
GIFAAGDVTTVPYKQIVISMGEGAKASLAAFEYLLSHEVIEMDEETQAA
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
gtgttaactaaagaaattttacaagcgttgaaaggctatgctgagtcaatgcagaaaaac
gtaaccttcgtcgtacagaccggtgaacacagcaagcgtgaagagcttgtgtcgtttctg
tccgacattgctggtgtaagtgacaaactaagccttgaagagcgcgacactaagggtgtt
ttacgcagctcaatcagttttttactggaagctgatggtgaagatacaggcattcgcttt
tctggtattcctggcggtcacgaatttaactcgcttatcttaggtatgcttcacgcatca
ggtaccgagcttaaaattgatgacagcgtaaaagcgattgttaaaggcgttaaagaagaa
cttaactttgaagtatttatcagcttaagctgccataactgcccagaagtcgttcaagcg
cttaaccaatttgcactacttaatccaaacattacgtctgaaatgattgacggtggattg
tatcaaaacgtagtagcagaacgtgatattcagggcgttccaagcgtttaccttaatggt
gagctattcgctaatggtaaggtcgatgcatcggttcttatcgataaacttatcgaacgt
gacccatcgctaaaagaggcgaacaaaggtgagtcgttaccgttacaagacgttaccgta
attggtggtggtccagcgggcgtggcatcagcgatatacagcgcacgtaaaggtttaaaa
gtgacagtggttgccgatcgtttcggtggtcaagtgaaagatacaatgggtattgagaac
ctaatctcagtatctaaaactaccggccctgagctagtaggtaatttaatggaacacatg
aacgattatgatattacgcttaaagagcacgttcgtgttgattctgtagaacaaggtaat
gttaaaacgattacgttatcgtctggtgaacaaattcgtactcgttcaattattgttgct
actggcgcacgttggagagaactcggtgtgccaggtgagaaagaaaacgtaggtaacggc
gtggcgtactgcccacactgtgatggtcctttctttaaaggtaaagacgttgcagttatt
ggtggaggcaactcgggtattgaagcggcacttgatttagcgggtattgttaaatcggta
acggtatttgaattcatgccagaacttaaagctgaccaagtactgattgaccaagctgaa
aaacgtgaaaatatcacgattatcagaaacgcagcgacgcatcaaatcactgctgagaat
ggaaaagttaatgctatcgagtatcaagatcgcaatactacagaactccatactctcccg
ctttcgggtgtgttcgttcagattggcctagtaccaaacagtcaattcatggaaggcgtg
gttgacatgagtaagtacggtgaaatcgttatcgatactaagtgcaacacgtctgcacca
ggtatatttgcagccggtgacgttacaacagtaccttacaagcaaatcgttatttcaatg
ggcgagggtgcaaaagcgtcattagcagcatttgaatacttgctaagccatgaagtcata
gagatggacgaagaaacacaagctgcctaa

DBGET integrated database retrieval system