KEGG   Alteromonas naphthalenivorans: ambt_07570Help
Entry
ambt_07570        CDS       T01513                                 

Definition
(GenBank) succinate dehydrogenase catalytic subunit
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00020  Citrate cycle (TCA cycle)
alt00190  Oxidative phosphorylation
alt00650  Butanoate metabolism
alt01100  Metabolic pathways
alt01110  Biosynthesis of secondary metabolites
alt01120  Microbial metabolism in diverse environments
alt01130  Biosynthesis of antibiotics
alt01200  Carbon metabolism
Module
alt_M00009  Citrate cycle (TCA cycle, Krebs cycle)
alt_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
alt_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:alt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ambt_07570
   00650 Butanoate metabolism
    ambt_07570
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ambt_07570
Enzymes [BR:alt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ambt_07570
    1.3.5.4  fumarate reductase (quinol)
     ambt_07570
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer4_18 Fer4_9 Fer4 Fer4_6
Motif
Other DBs
NCBI-ProteinID: AEF03042
UniProt: F5Z7J9
LinkDB All DBs
Position
1697388..1698098
Genome map
AA seq 236 aa AA seqDB search
MQLQFSIYRYNPDVDNKPRMQDYTLEVEEGRDMMVLDALIALKEQDPTLSFRRSCREGVC
GSDGVNMNGKNGLACITPLSALGKSKVVVRPLPGLPVVRDLVVDMTQFYTQYEKIKPFLI
NDDKQPPAREHLQSPEERAKLDGLYECILCACCSTSCPSFWWNPDKFIGPAGLLHAYRFL
IDSRDTATDERLNDLDDAFSVFRCHGIMNCVSVCPKGLNPTKAIGHIKSMLLQRAV
NT seq 711 nt NT seq  +upstreamnt  +downstreamnt
atgcaattacaattttcgatatatcgttacaaccctgatgttgataacaagccacgcatg
caagactacactctagaagtagaggaaggtcgtgacatgatggtgttggatgcactaatt
gctcttaaagagcaagatccaacgttatcattccgccgctcgtgccgtgaaggtgtgtgt
ggttcagacggtgtgaatatgaatggtaagaatggtcttgcctgtattacgccattgtct
gcattgggtaaaagtaaagttgttgttcgtccacttccaggtttgcccgtagtacgcgac
cttgtggttgatatgacacagttttacacccaatatgaaaagattaagccattcttaatc
aacgatgacaaacagcctcctgcaagagaacaccttcagtctcctgaagaacgtgctaag
cttgatggactgtatgaatgtattctatgtgcatgttgttctacgtcgtgcccatcgttc
tggtggaacccggataaatttatcgggcctgctggtttgcttcacgcttatcgtttcctt
atcgatagccgtgatactgcaactgatgaacgtttgaacgatctagatgatgcatttagc
gtattccgctgtcacggtattatgaactgtgtaagtgtatgtccgaaaggattaaacccg
acaaaggcaattggacacattaagtctatgcttttacaacgggctgtttag

DBGET integrated database retrieval system