KEGG   Alteromonas naphthalenivorans: ambt_17885
Entry
ambt_17885        CDS       T01513                                 

Definition
(GenBank) 2,3-dihydroxy-2,3-dihydrophenylpropionate dehydrogenase
  KO
K14582  cis-1,2-dihydro-1,2-dihydroxynaphthalene/dibenzothiophene dihydrodiol dehydrogenase [EC:1.3.1.29 1.3.1.60]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00624  Polycyclic aromatic hydrocarbon degradation
alt00626  Naphthalene degradation
alt01100  Metabolic pathways
alt01120  Microbial metabolism in diverse environments
alt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:alt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    ambt_17885
   00624 Polycyclic aromatic hydrocarbon degradation
    ambt_17885
Enzymes [BR:alt01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.29  cis-1,2-dihydro-1,2-dihydroxynaphthalene dehydrogenase
     ambt_17885
    1.3.1.60  dibenzothiophene dihydrodiol dehydrogenase
     ambt_17885
SSDB
Motif
Pfam: adh_short_C2 adh_short KR NAD_binding_10 DFP
Other DBs
NCBI-ProteinID: AEF05076
UniProt: F5Z5S1
LinkDB
Position
complement(4006670..4007467)
AA seq 265 aa
MKLQNQVAIITGASSGIGLAVAKRFISEGAKLGLLVRTEKDAKMLQDTFADNVVVTIGDV
RNYDDNEKLVQSTIDKFGTLDCFIGNAGIWDYMTPINSTEASLLESGYRDLFDVNLLGYI
LGAKAALPALKKSKGSMIFTASSSSYSLGGGGPLYVASKHAVLGFIRALAWESAPDIRIN
GVAAGGTLTPLCGPESLDLGGASLETSDGIEEMISAMTPLKFASKPEDHAGIFALLASRE
DAKYITGTVILSDGGIGLGMRPDQK
NT seq 798 nt   +upstreamnt  +downstreamnt
atgaaattgcaaaatcaagttgccattatcacaggagcttcttcaggaataggcttagcc
gttgcaaaacgctttatcagcgaaggagcaaagctagggcttttggttagaactgaaaaa
gatgccaaaatgctacaagatacttttgctgataatgttgtagtaaccataggtgatgtt
agaaattatgacgataacgaaaagcttgttcaatcaactattgataagtttggaacacta
gattgttttataggtaatgcaggtatttgggattatatgacaccaataaactcaacagaa
gctagtctattagaatcaggttatcgtgatttatttgatgttaatttacttggttatatt
cttggtgctaaggccgcgttacctgcacttaaaaaatctaaaggctctatgatttttact
gcatcatcatcaagctattcattaggtggaggaggtccattatatgttgcgtctaaacat
gcggttttaggctttattagagcattagcatgggagtcagctccagacattcgtattaat
ggtgttgctgctggtggcacattaacaccactatgtggccctgagagtttagacttaggt
ggggcaagccttgaaacatctgacggaatagaagaaatgattagtgctatgacaccacta
aaatttgcttccaagccagaagaccatgcaggaatatttgcattattagcctcaagagaa
gatgccaagtatattactggcactgttatcttaagcgatggcggtattggactaggcatg
agacctgatcaaaaatag

DBGET integrated database retrieval system