KEGG   Alteromonas naphthalenivorans: ambt_20945
Entry
ambt_20945        CDS       T01513                                 

Definition
(GenBank) hypothetical protein
Organism
alt  Alteromonas naphthalenivorans
SSDB
Motif
Pfam: DUF2859
Other DBs
NCBI-ProteinID: AEF05680
UniProt: F5Z717
LinkDB
Position
complement(4702784..4703278)
AA seq 164 aa
MKRVILIFCLSYMPMAQAGSPLIVIYDSGNTSPIAPYLPKRSGPQPKPPKPSSANKAFQL
PIETPSMSPGFVKVTAKPLKYLQQPLFLVGTDTRSRAWLEAKHSQLVKLNAVGLLIQADT
LKDIQAMQALATGLRLIPASAESFAKPLALKHYPVLISKDGWEQ
NT seq 495 nt   +upstreamnt  +downstreamnt
atgaagcgggttatactcatattctgcttaagctatatgccaatggctcaggccggtagt
ccgttaattgttatctacgattcgggcaacacttcgcctatcgcaccgtacttaccgaaa
cggtcagggcctcagccgaagccacctaaaccctcttcggcaaataaagcttttcaacta
cccatcgaaaccccgtcaatgtcacctgggtttgtcaaagtaaccgccaagccactcaaa
tatctgcaacaaccgctatttctcgtcggcaccgatactcgatcaagggcttggttggaa
gcaaagcacagccagctcgtaaaactcaatgccgtaggcttattgatacaggccgataca
ttgaaagatattcaggcgatgcaagccctggccacaggtttgcgattaatacctgcatcc
gctgagagttttgccaagccgttggcgttgaagcattacccggtactgatctcgaaggat
ggctgggagcaatga

DBGET integrated database retrieval system