KEGG   Allochromatium vinosum: Alvin_0262Help
Entry
Alvin_0262        CDS       T01168                                 

Definition
(GenBank) ATP dependent DNA ligase
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
alv  Allochromatium vinosum
Pathway
alv03030  DNA replication
alv03410  Base excision repair
alv03420  Nucleotide excision repair
alv03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:alv00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Alvin_0262
   03410 Base excision repair
    Alvin_0262
   03420 Nucleotide excision repair
    Alvin_0262
   03430 Mismatch repair
    Alvin_0262
Enzymes [BR:alv01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Alvin_0262
    6.5.1.6  DNA ligase (ATP or NAD+)
     Alvin_0262
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     Alvin_0262
DNA replication proteins [BR:alv03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    Alvin_0262
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     Alvin_0262
DNA repair and recombination proteins [BR:alv03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     Alvin_0262
   NER (nucleotide excision repair)
    Other NER factors
     Alvin_0262
   MMR (mismatch exicision repair)
    Other MMR factors
     Alvin_0262
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_OB_2 DNA_ligase_A_M
Motif
Other DBs
NCBI-ProteinID: ADC61227
UniProt: D3RMG9
LinkDB All DBs
Position
complement(309840..310802)
Genome map
AA seq 320 aa AA seqDB search
MRHNRETRYWERCAGFWSWRGAFLALILVLGCTPPVVADVSPRSVTAPQTTTEQAATPPA
LILANVYREGIDLSRYWVSEKLDGVRAYWDGSRLITRGGQPIAVPVWFTDGFPAIPLDGE
LWMGRGTFEVLSGTVRSLEPDHDAWRAVSYRVFDLPGMDAPFGERLQALERLLADTPNPR
IAPVEQFRVADHADLMARLETVVAGGGEGLMLHRDDAPYRAGRSDDLIKVKPYLDAEARV
IAHLPGKGKYEGMLGALLVEEPSGQRFRLGSGFSDAERRSPPPIGSRVTFKYHGRTRNGI
PRFASFLRVRDPATRSDSTH
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcggcacaacagagaaacgcgatattgggaacgctgcgccggcttctggagctggcgc
ggagcgttcctggcgctgatcctggttctcggctgtacaccgccagtcgtggcggacgtg
tccccacgctccgtcacggccccccagaccacgaccgagcaggctgcgacaccacccgcg
ctgatcctggccaacgtctaccgcgaaggcatcgatctgtcgcgctactgggtgagcgaa
aaactcgatggagtcagagcctattgggatggttccaggctgatcacacgcggcggtcag
ccgatcgcggtgcccgtctggttcacggacggctttccagccatcccgctggacggcgaa
ctctggatggggcgcggcaccttcgaggtcctgtcgggcacagtgcggagcctggaaccg
gatcacgacgcctggcgcgcggtgagctaccgggtcttcgacctgccgggtatggacgcc
cccttcggcgagcgcctccaggcgctcgaacgtctgctggccgacacgccgaatccgcgc
atcgcccccgtggaacaattccgggtcgccgatcacgccgacctgatggcgcgtctggaa
acggtcgtcgccggcggcggcgaagggctgatgctgcatcgcgacgacgccccctatcgc
gccggacgcagcgacgacctcatcaaggtcaagccctatctggacgccgaggcccgcgtg
atcgcgcatctgccgggcaagggcaagtacgaggggatgctgggcgcactcctggtcgag
gaaccctcggggcagcgcttccgtctcggcagcggcttcagcgacgccgagcgacgctca
ccgccaccgatcggcagccgcgtgaccttcaaataccacggacgcacccgcaacggcatt
ccacgcttcgccagctttctgcgcgtgcgagacccggccacacgctcagattcgacccac
tga

DBGET integrated database retrieval system