KEGG   Allochromatium vinosum: Alvin_2365Help
Entry
Alvin_2365        CDS       T01168                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
alv  Allochromatium vinosum
Brite
KEGG Orthology (KO) [BR:alv00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:alv03012]
    Alvin_2365
   03029 Mitochondrial biogenesis [BR:alv03029]
    Alvin_2365
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:alv04147]
    Alvin_2365
Translation factors [BR:alv03012]
 Eukaryotic Type
  Elongation factors
   Alvin_2365
 Prokaryotic Type
   Alvin_2365
Mitochondrial biogenesis [BR:alv03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Alvin_2365
Exosome [BR:alv04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Alvin_2365
  Exosomal proteins of breast cancer cells
   Alvin_2365
  Exosomal proteins of colorectal cancer cells
   Alvin_2365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADC63282
UniProt: D3RMZ4
LinkDB All DBs
Position
complement(2680043..2681233)
Genome map
AA seq 396 aa AA seqDB search
MSKEKFQRSKPHVNVGTIGHVDHGKTTLTAAITTHQAKKFGGEARAYDQIDNAPEERERG
ITIATAHVEYESDKRHYAHVDCPGHADYVKNMITGAAQMDGAILVCSAADGPMPQTREHI
LLSRQVGVPYIVVYLNKADMVDDAELLELVEMEVRELLSSYDFPGDDTPIITGSAKLALE
GDTSEIGGPSIDRLMEALDSYIPEPERAIDGAFLMPIEDVFSISGRGTVVTGRVERGIVK
VGEEVAIVGIKDTVKTICTGVEMFRKLLDQGQAGDNIGALLRGTKREDVERGQVLAKPGS
ITPHTHFEAEVYVLSKEEGGRHTPFFNGYRPQFYFRTTDVTGACELPEGIEMVMPGDNVK
MTIKLIAPIAMEEGLRFAVREGGRTVGAGVVAKIIE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgtccaaagaaaaatttcaacgtagcaagcctcacgtcaacgttggcacgattggccac
gtcgaccacggcaagaccacgctgacggcggcgatcaccacgcatcaggccaagaagttc
ggcggtgaggcgcgggcctacgaccagatcgacaacgccccggaagagcgcgagcgcggc
atcaccattgccacggcgcacgtggagtacgagagcgacaagcgtcactacgcccatgtc
gactgccccggtcacgccgactatgtcaagaacatgatcaccggcgcggcgcagatggac
ggcgcgattctggtgtgctcggccgccgacggcccgatgccccagacccgtgagcacatc
ctgctgtcacgtcaggtcggcgtgccctacatcgtggtgtacctgaacaaggccgacatg
gtcgacgacgccgagcttctggagctggtcgagatggaagtgcgcgagctgctctccagc
tacgacttccccggcgacgacaccccgatcatcaccggctcggccaagctggcgctggaa
ggcgacacctccgaaatcggcggtccctcgatcgaccgactgatggaggcgctcgacagc
tacattcccgagccggagcgggccatcgacggcgccttcctgatgccgatcgaagacgtg
ttctcgatctccggacgcggcaccgtggtgaccggacgtgtcgagcgcggcatcgtcaag
gtcggcgaagaagtggccatcgtcggcatcaaagacaccgtcaagaccatctgcaccggt
gtcgaaatgttccgcaagctgctcgaccagggtcaggccggtgacaacatcggcgccctg
ctgcgcggcaccaagcgtgaagacgtcgagcgtggtcaggtgctggccaagcccggctcg
atcaccccgcacacccacttcgaagctgaagtgtacgtgctgagcaaggaagagggcggt
cgtcacacccccttcttcaacggctatcgtccgcagttctacttccgcaccaccgacgtc
accggcgcttgcgagctgcccgaaggcatcgagatggtgatgccgggcgacaacgtcaaa
atgacgatcaagctgatcgcgccgatcgcgatggaagaaggtctgcgctttgcggtccgc
gagggcggtcgcaccgtcggcgcgggtgttgttgctaagatcatcgagtaa

DBGET integrated database retrieval system