KEGG   Allochromatium vinosum: Alvin_2639Help
Entry
Alvin_2639        CDS       T01168                                 

Definition
(GenBank) light-independent protochlorophyllide reductase, iron-sulfur ATP-binding protein
  KO
K04037  light-independent protochlorophyllide reductase subunit L [EC:1.3.7.7]
Organism
alv  Allochromatium vinosum
Pathway
alv00860  Porphyrin and chlorophyll metabolism
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alv00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Alvin_2639
Enzymes [BR:alv01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.7  With an iron-sulfur protein as acceptor
    1.3.7.7  ferredoxin:protochlorophyllide reductase (ATP-dependent)
     Alvin_2639
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer4_NifH CbiA AAA_31 ArsA_ATPase ParA AAA_24 AAA_26 MipZ MeaB AAA_25 SRP54 CBP_BcsQ NB-ARC
Motif
Other DBs
NCBI-ProteinID: ADC63548
UniProt: D3RPF8
LinkDB All DBs
Position
complement(2982270..2983175)
Genome map
AA seq 301 aa AA seqDB search
MQASSSGFHLSSHPDGEGSVQVQLDPDMQIEGAKVFAVYGKGGIGKSTTSSNLSVAFSKL
GKRVLQIGCDPKHDSTFTLTKCLVPTVIDILESVNFHAEELRPSDYVYEGYNGVMCVEAG
GPPAGTGCGGYVVGQTVKLLKQHHLLEDTDVVVFDVLGDVVCGGFAAPLQHAERALIVTA
NDFDSIFAMNRIAAAIKAKSKHYKVRLGGVIANRSRNTDEIDRFAEAVGLKRLAHLPDLD
IIRRSRLKKSTVFEMEPEPGSGLEAAQQQYLQLAQQLLDGVEPLEARPMADRDIFDFLGF
N
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcatcatccagcggcttccacctgtccagtcacccggacggggagggcagcgtg
caggttcagctcgaccccgacatgcagatcgagggcgccaaggtcttcgccgtctacggc
aagggcggcatcggcaagagcacgacgtcatcgaacctgtcggtcgctttctccaagctc
ggcaagcgcgtgctccagatcggctgtgatcccaagcacgactcgaccttcaccctgacc
aagtgtctggtgccgacggtcatcgacattctcgaatcggtgaacttccatgccgaggag
ctgcgtccgagcgactatgtctacgaaggctacaacggcgtgatgtgcgtcgaggccggc
ggtccgcccgccggtactggctgcggcggctatgtggtcggtcagacggtcaagcttctc
aagcagcaccatctgctcgaagacaccgatgtcgtggtgttcgacgtgctcggcgacgtg
gtctgcggcgggttcgccgcgccgctgcaacatgccgagcgcgcgctcatcgtcaccgcc
aacgacttcgactcgatcttcgccatgaaccgcatcgcggcggcgatcaaggccaagtcc
aagcattacaaggtccggctcggtggcgtgatcgccaaccgcagtcgcaacaccgacgag
atcgaccgcttcgccgaggcggtcgggctcaagcgtctggcccatctgccggatctcgac
atcatccgccgcagtcgtctcaaaaagtcgaccgtgttcgagatggagccggaacccggc
tcgggtctggaagcggcgcagcagcagtatctgcaattggcgcagcagttgttggatggc
gtcgagccgctggaggcccgtccgatggccgaccgcgacatcttcgattttctggggttc
aattga

DBGET integrated database retrieval system