KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_314227Help
Entry
ARALYDRAFT_314227 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00010  Glycolysis / Gluconeogenesis
aly00051  Fructose and mannose metabolism
aly00052  Galactose metabolism
aly00500  Starch and sucrose metabolism
aly00520  Amino sugar and nucleotide sugar metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
Module
aly_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aly_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_314227
   00051 Fructose and mannose metabolism
    ARALYDRAFT_314227
   00052 Galactose metabolism
    ARALYDRAFT_314227
   00500 Starch and sucrose metabolism
    ARALYDRAFT_314227
   00520 Amino sugar and nucleotide sugar metabolism
    ARALYDRAFT_314227
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ARALYDRAFT_314227
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aly04131]
    ARALYDRAFT_314227
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     ARALYDRAFT_314227
Membrane trafficking [BR:aly04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    ARALYDRAFT_314227
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1
Motif
Other DBs
NCBI-GeneID: 9330134
NCBI-ProteinID: XP_002894073
UniProt: D7KBX4
LinkDB All DBs
Position
Unknown
AA seq 491 aa AA seqDB search
MSLMFSSPVVTPTIGSFTFSSRRSNYIVMSAVRSNSASTCPVLTKFQKDCATPTPYLRNV
ANAIADDMRAGLAVEGGGDLDMILTYVDALPSGNEEGLFYALDLGGTNFRVRSVQLGGKK
KRVVATESEQISIPQKLMIGTSEELFGFIAAKLASFVAKEKPSRFRLEEGRKREIGFTFS
FPVKQTSIDSGTLIKWTKGFKVSGMEGKNVVACLNKAMEAHGLDMRVSALVNDGVGTLAG
ARYSEEDVMIGVILGTGTNACYVEQKHAIPKLQSKSSSGTTIINTEWGGFSKVLPKTIFD
QEMDAKSPNPGEHLYEKMISGMYLGEIVRRVLLQMCETSDLFGQFVPVKLSTPFELRTEH
LCEMQADTTDDLQTVGSVLYNILEVEANLQERRRVVEVCDTVVKRGGRLAGAGIVAILEK
IEKETKRMGSGKRTVVAMDGALYEKYPQYREYMQDALVELLGDKLSHIAIKHTKDVSGLG
AALLAATNSIY
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atgtcactcatgttttcttcccctgtcgtcaccccaaccatcggatctttcaccttctca
tctcgacgctcaaactacatcgtgatgtccgccgtccgatctaactcggcttcgacgtgt
cctgtactaaccaagtttcagaaggactgtgccactcctacaccgtatctacgcaacgta
gccaacgccattgctgatgacatgcgagctggtctagctgttgaaggaggaggagatctc
gatatgatcttgacttatgttgacgctttgccttctgggaatgaggaagggttgttctat
gcattggatttaggaggtacaaattttcgggtgcgtagcgtgcaattaggaggaaagaaa
aagcgagtcgtagctaccgaatctgaacaaatatctattcctcaaaagcttatgattggt
acaagtgaggaactctttgggttcattgctgcaaagcttgcaagctttgttgcaaaggag
aagccgagtcggtttcggttagaagaagggaggaaaagggagatagggtttaccttttca
ttccctgtgaagcaaacttctattgattctggcacattaatcaagtggactaaaggcttt
aaagtgtctggaatggaaggaaaaaacgtggttgcttgtttaaataaagctatggaagct
catggactcgacatgcgagtttctgctctcgtaaatgatggagtgggaacattagctgga
gcaaggtattcggaagaggatgtgatgatcggtgtgattcttggcactggaaccaatgct
tgttatgtagagcagaagcatgcaattcctaaactccaaagcaaatcttcttctggaaca
acgatcataaacacggagtggggaggattctctaaggttcttccgaaaaccatttttgac
caagagatggatgcgaaaagcccgaatcctggtgaacatttatatgagaagatgatctca
gggatgtaccttggtgaaattgtaagaagggttttgctccaaatgtgtgaaactagtgac
ttgttcggacaattcgttcctgtaaaactctccactccctttgaactcaggaccgagcat
ctatgcgaaatgcaagcggacactacagatgatcttcagacggttggatcagtcctatac
aacattttagaggtagaggcaaatctgcaggaaaggaggagagtggtggaagtgtgtgac
acagtagtgaaacgcggagggcgtctagcaggagctggtatagtggcaattctggagaaa
attgaaaaagagaccaaaagaatgggttctggtaaaagaaccgttgtggctatggacggt
gcactatacgagaagtacccacagtatcgagagtatatgcaagatgcactagtcgagctt
cttggcgataagctaagtcacattgcgatcaaacataccaaagacgtgtctgggctcggt
gctgctcttttggccgccactaactccatttactag

DBGET integrated database retrieval system