KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_330553Help
Entry
ARALYDRAFT_330553 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01110  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase and dual-specificity protein phosphatase PTEN [EC:3.1.3.16 3.1.3.48 3.1.3.67]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00562  Inositol phosphate metabolism
aly01100  Metabolic pathways
aly04070  Phosphatidylinositol signaling system
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    ARALYDRAFT_330553
 09130 Environmental Information Processing
  09132 Signal transduction
   04070 Phosphatidylinositol signaling system
    ARALYDRAFT_330553
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:aly01009]
    ARALYDRAFT_330553
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     ARALYDRAFT_330553
    3.1.3.48  protein-tyrosine-phosphatase
     ARALYDRAFT_330553
    3.1.3.67  phosphatidylinositol-3,4,5-trisphosphate 3-phosphatase
     ARALYDRAFT_330553
Protein phosphatases and associated proteins [BR:aly01009]
 Protein tyrosine phosphatases (PTPs)
  Class I PTPs (Dual specificity phosphatases)
   Phosphatase and Tensin homologs (PTEN)
    ARALYDRAFT_330553
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PTEN_C2 DSPc Y_phosphatase3 PTPlike_phytase Y_phosphatase DUF4070 TilS
Motif
Other DBs
NCBI-GeneID: 9304793
NCBI-ProteinID: XP_002870781
UniProt: D7MJM4
LinkDB All DBs
Position
Unknown
AA seq 412 aa AA seqDB search
MGLKLSRGPVKEKSTLEFTRVHILTYLSTSSYLRSLVSKKRRRLIIGGYDLDMSYISDKL
LAMSFPAERMRAVYRNPLWQVKSVLDMRHPDHYKVYNLCIEESYDPENFYGRVERFPFDD
NHVPSLKMIQLFCESVHSWLSLDPKNIAVVHCMAGKGRTGLMVSAYLVYGGMSAEEALEM
YASRRTTNNNGVSIPSQRRYVKYWSDLLSFRKRGPPEVKLPQEHSRELLRIRLYDTANVD
SVFFVVSELQEVPNEMYRPSVELARGCCRQFKKGYCRSSSPRYYISHVNCDSEEDEEVTD
GEEPRLVVQMDTESSIIDEKTCLDFYFDKPVRVSGDIRITFYQKMIGSRLFYTCFNTAFI
TNGLLQFSIGELDKVGGNGRSISGPDFSLELLFGPACSKFGKFLSRDDLSLS
NT seq 1239 nt NT seq  +upstreamnt  +downstreamnt
atgggtctcaagctctcaagagggcctgtaaaagaaaaatcaactttggaatttacgagg
gttcacattctaacttaccttagcacaagttcttacctacgtagcttggtgtccaagaaa
cgaagacggttaatcatcggtggatatgatctcgacatgtcttacatctctgacaaatta
ttggcaatgtcttttccagctgaacgaatgagagcagtttatagaaaccctctttggcaa
gtcaaatccgtgctcgatatgcgacatcctgatcattacaaggtctataatctatgtata
gaggaatcttatgatccagaaaacttctatggccgcgtggaacgatttccgtttgatgac
aatcatgttccatctctcaaaatgatccaacttttctgcgaaagtgttcattcttggctc
tcactagatcccaagaacatcgcggttgttcattgcatggcaggaaaaggcagaacaggg
ttaatggtatcggcgtaccttgtttatggtggaatgtcagctgaagaagctcttgagatg
tatgcaagcagaagaacaacaaacaataatggagtctcaataccaagccaacgtcgttat
gtgaaatactggtcagatttactttcgtttcgtaaaaggggacctcccgaggttaaatta
cctcaagaacatagcagagagttgcttcgaattagactttacgatacagccaacgttgat
tccgtcttctttgtggtctcggaacttcaggaggttccaaatgagatgtatcgaccgtct
gtagaacttgcaagaggttgttgtagacaattcaagaaagggtattgtagaagctcgagt
ccacggtattatatatctcatgtgaactgtgattcagaagaagatgaggaagtaacagat
ggagaagagccacgtcttgttgttcaaatggatacagagagttcaattatcgacgagaaa
acatgtcttgatttctactttgacaaacctgtgagagtgagtggagacatacgcatcaca
ttctaccagaaaatgattggaagccgtcttttttatacttgcttcaacacagcttttata
accaatggcttacttcagttttccataggagagctagataaagttggtggtaacggaaga
tcgatatctggtcctgattttagcttggagttactctttggcccagcttgttcaaaattc
ggaaagtttctttcccgcgatgacctttctctctcttaa

DBGET integrated database retrieval system