KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_332733Help
Entry
ARALYDRAFT_332733 CDS       T01578                                 

Gene name
SDH2-3
Definition
(RefSeq) succinate dehydrogenase 2-3
  KO
K00235  succinate dehydrogenase (ubiquinone) iron-sulfur subunit [EC:1.3.5.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00020  Citrate cycle (TCA cycle)
aly00190  Oxidative phosphorylation
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARALYDRAFT_332733 (SDH2-3)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ARALYDRAFT_332733 (SDH2-3)
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ARALYDRAFT_332733 (SDH2-3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Fer2_3 Fer4_17 Fer4_8 Fer4_10 Fer4_7 Fer2 Fer4_18 Fer4_9
Motif
Other DBs
NCBI-GeneID: 9302725
NCBI-ProteinID: XP_002866653
UniProt: D7MT85
LinkDB All DBs
Position
Unknown
AA seq 309 aa AA seqDB search
MATVLRFLGRRICNPAAEKVRLSSSLSEGGDFPVLKGQKAAQDLSKDTLKSHEITKEKEG
QHKEAKKEFKIYRWNPDKPNSKPFLQSFFVDLSSCGPMVLDVLQKIKAEEDASLSYRRSC
REGICGSCSMNIDGTNTVACLKPINPNSSKPTIITPLPHMYVIKDLVVDLTNFYQQYKAM
EPWLKTRKPPKDGREHRQSPKDRKKLDGLYECILCACCTTSCPSYWWNPEEFPGPAALLQ
AYRWISDSRDEFGEERLQAITENQTKVYRCRAIKNCTATCPKGLNPASAILKMKSKHFLS
DPVVRTESL
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atggcgactgtcttgcggtttttagggcgtagaatctgcaatccagcggcggagaaagta
cgtttgagcagtagcttaagcgagggaggtgattttccggtcttaaaaggccagaaagcg
gctcaagacttatccaaagatactctaaagtcccatgaaataacaaaagagaaagaaggc
caacacaaagaagctaagaaggagttcaagatttacagatggaatcctgacaaacctaac
tctaaaccatttcttcaatctttcttcgttgatctttcctcttgtggtcccatggttttg
gacgtactgcagaagataaaagcagaggaagatgccagtttgagttacagaagatcatgt
agagaaggaatatgtggatcttgctcgatgaacatcgacggtactaatactgtcgcatgt
cttaaacccataaaccccaactcgtcgaagcccaccataattactccattgcctcacatg
tacgtcatcaaagacctagtcgtcgacctcactaatttttatcaacaatacaaagcaatg
gagccatggttaaagacgaggaagcctccaaaagacggacgtgaacaccgacaatcacca
aaagaccggaagaaactagacgggctatacgaatgcatattgtgcgcgtgttgtaccaca
tcatgtccttcttattggtggaaccctgaggagtttccaggacccgcggctttactacaa
gcgtatcgttggatcagtgatagccgtgatgagtttggagaagagagacttcaggcgata
actgagaatcaaaccaaagtatatagatgcagagcaatcaagaactgtacggccacttgt
cctaaaggacttaatccagctagtgctattttgaaaatgaagtctaagcattttctctcc
gatccggttgtgagaaccgagagtctctag

DBGET integrated database retrieval system