KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_338905Help
Entry
ARALYDRAFT_338905 CDS       T01578                                 

Definition
(RefSeq) ATP dependent DNA ligase family protein
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DRMBL DNA_ligase_A_C RMMBL Lactamase_B_2
Motif
Other DBs
NCBI-GeneID: 9324608
NCBI-ProteinID: XP_002887071
UniProt: D7KUD3
LinkDB All DBs
Position
Unknown
AA seq 1413 aa AA seqDB search
MATDSSGVTISGNFSNGENAETLNLDTTELYSSAISSVSTQSPPPKPPFSSLSIPQSKRI
PKTNFIVDLFRFPQHSSTSVAFFLSHFHSDHYSGLSSTWSKGIIFCSHKTARLVEEILQV
PSQFVFALPMNQMVMIDGSEVVLIEANHCPGAVQFLFKVKLENGGFERYVHTGDFRFCDE
MRFDSFLSGFIGCDGVFLDTTYCNPKFVFPTQEESVGYVVSVIDKIDGECVETKKKVLFL
VATYVIGKEKILVEIARRCKRKIVVDLRKMSILGILGCGESGMFTEDVNESDVHVVGWNV
LGETWPYFRPNFVKMNEIMVEKGYDKVVGFVPTGWTYEVKRNKFAVRFKDSMEIHLVPYS
EHSNYDELREYIKFLKPKRVIPTVGVDIEKLDSKEVNKMQKHFSGLVDEMANKKDFLLGF
YCQSYQKNEKNDVDVVSGLAEVYAGDDKNACEDGGDNVPSSRGPLLHDTAPSSDSSVTER
LLVELRDSLPAWVTEEQMLNLIKKHAGNPVEIVSNFYECEAELYKQSSLPTLSLENQPVL
FDDDVTDLQPNPVKSTCPDVQAVQEGFDLPKKMNLTKGTISPGKRGKSSGSKSNKKAKKD
PKSRPVSPRQPTIFKFFNKVLDSGSNSVGVGSETEECNTDKKMVHNDATEAYKEVTDQFI
DIVNGSESLRDYAASIIDEAKGDINRALNIYYSNPIPGEGGLSSKSIQFSHCPEACSSQE
GKKASEKSGHAVNICVQSSAEEIVDKNYVSLPPEQYKPKEHACWRDGQPAPYIHLVRTFA
SVESEKGKIKAMSMLCNMFRSLLALSPEDVLPAVYLCTNKISADHENIDLNIGGSLISSA
LEEACGISRPTVRDMYNSTGDLGKEKSIPSQLTYGDVAQLCRQTQKLLVPPPPLLIRDVF
STLRKISVQSGTGSTRQKKNLIVKLMRSCREKEIKFLVRTLVRNLRIGAMLRTVLPALGR
AIVMNSFWSCHNKELSENCFREKLEGVSAAVVEAYNILPSLDVVVPSLMDKDIEFSTSTL
SMVPGIPIKPMLAKIAKGVEEFFELFQDKAFTCEYKYDGQRAQIHKLLDGTVRIFSRNGD
ETTARFPDLVDVIKQFSCPVAETFMLDAEVVAIDRKNGSKFMSFQELSTRERGSKDALVT
TESIKVEVCVFVFDIMFGNGEQLLALPLRERRRRLKEVFPEIRPGYLEYAKEITVEAEEA
SLNNQDTLSRINAFLGEAFQSSCEGIMVKSLDIDAGYFPTKRYDSWLKVKRDYVDGLGDT
LDLVPIGAWHGNGRKAGWYSPLLMACFNPETEEFQSVCRVMSGFSDAFYIEMKELYSGDK
ILTKKPPYYRTGETPDMWFSTEVVWEIRGADFTVSPVHSAALGLVHPSRGISVRFPRFIR
KVTDRNPEECSTAADIAEMFHAQTRKLNITSQH
NT seq 4242 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgattccagcggagtcacaatctccggcaatttctcaaatggcgagaacgca
gaaaccctaaacctcgacactacagaactctactcatcagcaatatcctccgtctctaca
caatctcccccaccgaaaccaccgttctcatctctttcaatccctcaatcaaaacgaatc
cctaaaactaacttcatcgtcgatctcttccgcttcccacaacattcctccacctccgtc
gctttcttcctctcacatttccattccgatcactattccggtctctcctctacttggtct
aaaggaattatcttctgctcacacaaaaccgctcgtctcgtcgaagaaatccttcaagtt
ccttcacaattcgtcttcgctttacctatgaaccaaatggttatgatcgatggctctgaa
gttgtgttgattgaagcaaatcactgtccaggagcggtacagtttttgtttaaagtcaaa
ttagagaacggtggatttgagaggtatgttcatactggagatttcagattctgtgatgag
atgagatttgattcgtttcttagtggttttattggatgtgatggtgtttttctggatact
acttattgtaatcctaagtttgtttttccgacgcaagaggaatctgttggttatgttgtt
agtgtgatagataagattgatggtgagtgtgtggagacgaagaagaaggttttgtttctt
gttgctacttatgttattggtaaagagaagattttggttgagattgctaggagatgtaag
aggaaaattgttgtggatctcaggaagatgtcgattttggggattttggggtgtggggag
agtggaatgtttacggaggatgtgaatgagagtgatgttcatgttgtggggtggaatgtg
ttgggagagacttggccgtattttcggccgaattttgtgaagatgaatgagattatggtc
gagaaagggtatgataaggttgtaggttttgtgcctacagggtggacttatgaagtgaag
cggaataagtttgcggttaggtttaaagattcgatggagattcatcttgtaccgtatagt
gagcattcaaactatgatgagcttagagagtacataaagttcttgaaacctaaaagagtt
attcctacagttggagttgatatcgagaagcttgatagcaaggaggttaataagatgcag
aaacatttttctggattggtagatgaaatggcaaacaagaaagattttttattgggtttc
tattgccagtcttaccagaagaatgagaaaaatgacgtagatgttgtgtcaggcttggct
gaggtctacgcaggggacgataaaaatgcatgtgaagacggtggagataatgttccatca
tctagaggacccttattgcatgatacagctccaagtagtgattcttcggtgaccgaaaga
ttgcttgtagaactacgtgattctttgcctgcttgggtcactgaagagcagatgttaaat
ctgattaagaagcatgctggtaatcccgtggaaatagttagtaacttttatgaatgtgaa
gcagagctttacaagcaatcctctcttcccacgctttccttggaaaatcagcctgttttg
tttgatgacgatgtaacagacttgcaaccaaatcctgtgaagagcacttgtccagatgtt
caagcagttcaagaaggttttgacttaccaaaaaaaatgaatttaacaaagggtactatt
tctcctgggaaaagaggcaaaagctcgggcagtaaatcaaacaagaaggccaagaaagat
ccaaaatcaagaccagttagtccaaggcagccaaccatttttaagttcttcaataaggtc
ttggatagtggatctaattctgttggtgttggatcagagactgaagagtgtaatacagat
aaaaagatggtccacaatgatgctacagaagcatacaaagaagtgacagatcaatttatt
gatattgttaatggctctgaatctctaagagattatgctgcttccatcattgatgaggct
aaaggagatataaatagggcactgaacatctattacagtaaccccatacctggtgaggga
ggactctccagcaaatcaattcagttttcgcattgtccagaagcgtgctcctctcaggag
gggaaaaaggcgtcagaaaagtcaggacatgcagtcaacatatgtgtgcagtcatcagca
gaggaaattgtggacaaaaattatgtatctctacctcctgaacaatataaacctaaagag
cacgcctgttggagggatggacagcctgctccatatatccacctagtccgaacatttgct
tctgttgaaagtgaaaagggaaagatcaaagctatgtctatgctttgcaacatgtttaga
agcttgttggctctctctccagaagatgttctgcccgctgtttatctttgcacaaataag
atttcggctgaccatgagaatattgatcttaacattggtggaagtctaatctcttctgca
ttggaagaagcatgtggaataagtcggcctactgtgagggatatgtataatagcaccgga
gatcttggtaaagaaaaatctatcccatcacagttaacttatggagatgttgcgcagcta
tgtcgacaaacgcaaaagctactggttcctccacctccacttctaatcagagatgtgttt
tcaactctacgaaagataagtgtgcagtcaggtactggaagtactaggcaaaagaaaaac
cttatcgtgaagctaatgcgctcttgtagagagaaagagatcaaatttcttgtaagaaca
ttggtccgtaatttaaggattggcgctatgttgagaactgttcttcctgcacttgggcga
gcaatcgttatgaattctttttggagttgccataacaaagaactgtcagaaaactgtttc
agggagaaacttgagggagtttctgctgcagtagttgaggcttacaatatacttccttct
ctggacgtggttgttccttctctcatggacaaagacattgagttttcaacgtcaactcta
tcaatggttccagggatacctataaaacccatgcttgctaaaattgctaagggcgtcgaa
gaattttttgagctcttccaagacaaggcgtttacttgtgaatacaaatatgatggtcag
cgtgcccagatccataagttacttgatggtactgtgcgtatcttctctcggaatggggac
gaaacaacagcgagatttccggatcttgttgatgtcataaaacagttttcttgccctgta
gcggagacattcatgttggacgcagaggtggttgcaattgatagaaaaaatggaagcaaa
ttcatgtcattccaagagttatcaacaagagagagagggagcaaagatgctttggtaact
accgaaagtattaaggttgaagtctgcgtctttgtgtttgatattatgttcggcaatgga
gaacagctgttggctcttcctctccgtgagagaagaagacgtctaaaggaggtcttccct
gagattaggccaggttatcttgaatatgctaaggaaattacagtggaagcagaagaagct
tctttgaataatcaggacactttgagtagaataaatgcttttttgggagaggcatttcag
tcatcttgcgaaggaatcatggttaagtctttagatattgatgcaggatacttccccaca
aagcgttatgattcatggctcaaggttaagcgagattatgtagatggattgggcgacaca
ttagatttagttcctataggtgcttggcatggcaacgggagaaaagcgggatggtatagt
ccactccttatggcctgcttcaaccctgagactgaggaattccagagtgtctgccgtgtc
atgtctgggttttctgatgccttttacatcgagatgaaagaactctactcaggggataag
atccttacgaaaaagccgccttactacagaacaggggaaacacctgacatgtggttttcc
acagaggttgtttgggaaatcagaggtgcagatttcacggtctcgcctgttcacagtgcc
gctttaggtctcgtccatccatcccgaggtatctccgttaggtttccgagatttattcgt
aaagtaacagacagaaatccggaggaatgcagcacggctgcagatatcgcagagatgttt
catgctcaaaccagaaaattgaacatcacctctcaacattaa

DBGET integrated database retrieval system