KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_474459Help
Entry
ARALYDRAFT_474459 CDS       T01578                                 

Definition
(RefSeq) ATPPC1
  KO
K01595  phosphoenolpyruvate carboxylase [EC:4.1.1.31]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00620  Pyruvate metabolism
aly00710  Carbon fixation in photosynthetic organisms
aly01100  Metabolic pathways
aly01200  Carbon metabolism
Module
aly_M00168  CAM (Crassulacean acid metabolism), dark
aly_M00170  C4-dicarboxylic acid cycle, phosphoenolpyruvate carboxykinase type
aly_M00171  C4-dicarboxylic acid cycle, NAD - malic enzyme type
aly_M00172  C4-dicarboxylic acid cycle, NADP - malic enzyme type
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ARALYDRAFT_474459
  09102 Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ARALYDRAFT_474459
Enzymes [BR:aly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.31  phosphoenolpyruvate carboxylase
     ARALYDRAFT_474459
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PEPcase PEPcase_2
Motif
Other DBs
NCBI-GeneID: 9327804
NCBI-ProteinID: XP_002894435
UniProt: D7KKG4
LinkDB All DBs
Position
Unknown
AA seq 967 aa AA seqDB search
MAYRKLEKMASIDVHLRQLVPGKVSEDDKLVEYDALLLDRFLDILQDLHGEDLRETVQEL
YEHSAEYEGKHEPKKLEELGNVLTSLDPGDSIVIAKAFSHMLNLANLAEEVQIAYRRRIK
KLKKGDFVDESSATTESDLEETFKKLVGDLNKSPEEIFDALKNQTVDLVLTAHPTQSVRR
SLLQKHGRIRDCLAQLYAKDITPDDKQELDEALQREIQAAFRTDEIKRTPPTPQDEMRAG
MSYFHETIWKGVPKFLRRVDTALKNIGIEERVPYNAPLIQFSSWMGGDRDGNPRVTPEVT
RDVCLLARMMAATMYFNQIEDLMFEMSMWRCNDELRVRADELHANSRKDAAKHYIEFWKS
IPTTEPYRVILGDVRDKLYHTRERAHQLLSNGHSDVPVEATFINLEQFLEPLELCYRSLC
SCGDRPIADGSLLDFLRQVSTFGLSLVRLDIRQESDRHTDVLDAITTHLDIGSYREWSEE
RRQEWLLSELSGKRPLFGSDLPKTEEIADVLDTFHVIAELPADSFGAYIISMATAPSDVL
AVELLQRECRVKQPLRVVPLFEKLADLEAAPAAVARLFSVDWYKNRINGKQEVMIGYSDS
GKDAGRLSAAWQLYKAQEELVKVAKEYGVKLTMFHGRGGTVGRGGGPTHLAILSQPPDTI
NGSLRVTVQGEVIEQSFGEEHLCFRTLQRFTAATLEHGMRPPISPKPEWRALLDEMAVVA
TEEYRSVVFQEPRFVEYFRLATPELEYGRMNIGSRPSKRKPSGGIESLRAIPWIFAWTQT
RFHLPVWLGFGSAIRHVIEKDVKNLHMLQDMYQHWPFFRVTIDLIEMVFAKGDPGIAALY
DKLLVSEELWPFGEKLRANFEETKKLILQTAGHKDLLEGDPYLKQRLRLRDSYITTLNVC
QAYTLKRIRDPSYHVTLRPHISKEIAESSKPAQELIELNPTSEYAPGLEDTLILTMKGIA
AGLQNTG
NT seq 2904 nt NT seq  +upstreamnt  +downstreamnt
atggcgtatcggaagttagagaagatggcatcaattgatgttcatcttcgtcaactggtt
cctggtaaagttagtgaagacgacaagcttgttgagtatgatgcgttgcttctagatcgg
tttctcgatattctccaggatttgcacggtgaagatctccgtgaaactgttcaagagctt
tatgagcattctgcagaatacgaagggaagcatgaaccgaagaagttagaggagctaggg
aatgtgctaacgagtttagatccaggagactccattgttatcgctaaagctttctctcac
atgcttaacctagccaatttggctgaggaagtgcagattgcttaccgtcgtaggatcaag
aagctgaagaaaggtgattttgttgatgagagctctgctactactgaatctgatcttgaa
gaaactttcaagaagcttgttggagatctgaataagtctcctgaagagatatttgatgct
ctgaagaatcagactgtggatttggttttgactgctcatcctactcagtctgtgagaaga
tcattgcttcagaaacatgggaggataagagactgtctggctcaactttatgctaaggat
attactcctgatgacaagcaagagctcgatgaggctcttcagagagagattcaagcggca
ttccgaacagatgaaatcaaaagaacaccaccgactcctcaagatgagatgagagcagga
atgagttatttccatgaaactatctggaaaggtgttcctaagtttcttcgccgtgtagac
acagctttgaaaaacatagggattgaagaacgtgttccatataatgctccattgattcaa
ttctcttcttggatgggtggtgatcgtgatggtaatccaagggttacacctgaagtcacc
agagatgtttgcttgttagctagaatgatggctgctactatgtactttaaccaaatcgaa
gatcttatgtttgagatgtctatgtggcgttgcaatgacgagctgcgtgtgcgagctgat
gaacttcacgcaaattcgagaaaagatgctgcgaaacattacatagaattctggaagtca
attcctacaaccgagccataccgtgtgattcttggcgatgtaagggacaagctttatcac
acacgtgaacgcgctcatcaattgctcagcaatggacactctgatgtccctgtagaggct
actttcattaacttggaacagttcttggaacctcttgagctctgttaccgatctctttgt
tcatgtggcgaccgtccaatagcagatggaagccttcttgattttttgaggcaagtctca
acctttgggctctctcttgtgagacttgacataaggcaagaatctgaccgccacaccgat
gtattggatgctatcaccacacatttagatatcggatcctacagagaatggtctgaagaa
cgtcgccaagaatggcttttatctgagctaagtggcaaacgtccgcttttcggttctgat
cttcctaaaaccgaagaaatagctgatgttctggacacgtttcatgtcatagcagagcta
ccagcagacagctttggtgcttacattatctctatggcaactgcaccttctgatgtatta
gctgttgagcttttacagcgtgaatgccgtgtgaaacagcctttgagagttgttccgctc
tttgagaagctagcggatctggaagcagctcctgctgcagttgctaggctcttttctgtt
gattggtacaagaaccgtattaacggtaagcaagaggttatgattggttattcggattca
gggaaagacgctggacggttatccgctgcttggcagttatacaaagctcaagaagagctt
gtgaaggttgctaaagagtatggtgtgaagctaacaatgtttcacggtcgtggtggcacg
gttggaagaggaggcggaccgacccatcttgctatattgtctcagcctccggatactatt
aacggttcgctccgtgtcacggttcaaggtgaagtcatcgagcaatcgtttggtgaagag
catttatgctttagaacacttcagcgtttcaccgctgctacactcgagcacggtatgcgt
cctccaatttcgcctaaaccagaatggcgcgctttgcttgatgaaatggcggtcgttgca
accgaggagtatcgttctgttgtgttccaagaacctcggtttgtcgagtacttccgcctt
gctacaccggaactagagtatggtcgtatgaacattggaagcagaccttcgaagcgtaaa
ccaagtggtggcattgaatctctccgtgctattccatggatcttcgcttggactcaaaca
agattccatctccctgtatggcttggatttggatcagcgattagacacgtgatcgaaaaa
gacgtcaagaacctccatatgctccaagatatgtaccaacactggcctttctttagagtc
accattgatctcattgaaatggtgttcgctaaaggagatcctgggattgctgctttgtac
gataagcttcttgtttcagaggaactctggccttttggtgagaaactcagagctaatttc
gaagaaaccaagaaactcatcctgcagaccgctggacacaaagatcttcttgaaggagat
ccttacttgaaacagagactgagactccgtgattcttacattacgactctcaatgtctgt
caagcttacacattgaagagaatccgtgatccaagttaccatgtgactctgcgacctcac
atctctaaggagatagcagaatcgagcaaaccagcacaagaactcatcgagcttaacccg
acaagcgaatacgcgcctggacttgaagatacactcatcttgaccatgaagggtattgct
gctggtctacaaaacaccggttaa

DBGET integrated database retrieval system