KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_475563Help
Entry
ARALYDRAFT_475563 CDS       T01578                                 

Definition
(RefSeq) large subunit of riblose-1,5-bisphosphate carboxylase/oxygenase
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00630  Glyoxylate and dicarboxylate metabolism
aly00710  Carbon fixation in photosynthetic organisms
aly01100  Metabolic pathways
aly01200  Carbon metabolism
Module
aly_M00165  Reductive pentose phosphate cycle (Calvin cycle)
aly_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
aly_M00532  Photorespiration
aly_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    ARALYDRAFT_475563
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    ARALYDRAFT_475563
Enzymes [BR:aly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     ARALYDRAFT_475563
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 9324412
NCBI-ProteinID: XP_002888349
UniProt: D7KRA6
LinkDB All DBs
Position
Unknown
AA seq 479 aa AA seqDB search
MSPQTETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHVHAGTVVGKLEGDRESTLGFVDLLRDDYVEKDRSR
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAVEGNEIIREACKWSPELAAACEVWKEIRFNFPTVDKLDGQE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgttaaagagtat
aaattgacttattatactcctgaatatgaaaccaaggatactgatatcttggcagcattc
cgagtaactcctcaacctggagttccacctgaagaagcaggggctgcggtagctgctgaa
tcttctactggtacatggacaactgtgtggaccgatgggcttaccagccttgatcgttac
aaaggacgatgctaccacatcgagcccgttccaggagaagaaactcaatttattgcgtat
gtagcttaccccttagacctttttgaagaaggttcggttactaacatgtttacctcgatt
gtgggtaatgtatttgggttcaaagccctggctgctctacgtctagaggatctgcgaatc
cctcctgcttatactaaaactttccaaggaccacctcatggtatccaagttgaaagagat
aaattgaacaagtatggacgtcccctattaggatgtactattaaaccaaaattggggtta
tccgcgaagaactatggtagagcagtttatgaatgtctacgtggtggacttgattttacc
aaagatgatgagaatgtgaactcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagctatttataaatcacaggctgaaacaggtgaaatcaaagggcattatttg
aatgctactgcgggtacatgcgaagaaatgatcaaaagagctgtatttgccagagaattg
ggagttcctatcgtaatgcatgactacttaacagggggattcaccgcaaatactagtttg
gctcattattgccgagataatggcctacttcttcacatccaccgtgcaatgcacgctgtt
attgatagacagaagaatcatggtatgcacttccgtgtactagctaaagctttacgtcta
tctggtggagatcatgttcacgcgggtacagtagtaggtaaacttgaaggagacagggag
tcaactttgggctttgttgatttactgcgcgatgattatgttgaaaaagatcgaagccgc
ggtatctttttcactcaagattgggtctcactaccaggtgttctgcctgtggcttcaggg
ggtattcacgtttggcatatgcctgctttgaccgagatctttggagatgattctgtacta
caattcggtggaggaactttaggccacccttggggaaatgcaccgggtgccgtagctaac
cgagtagctctggaagcatgtgtacaagctcgtaatgagggacgtgatcttgcagtcgag
ggtaatgaaattatccgtgaagcttgcaagtggagtcctgaactagctgctgcttgtgaa
gtatggaaagagatcagatttaacttcccaaccgtcgataaattagatggccaagagtag

DBGET integrated database retrieval system