KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_476894Help
Entry
ARALYDRAFT_476894 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
SSDB OrthologParalogGFIT
Motif
Pfam: SET zf-CW
Motif
Other DBs
NCBI-GeneID: 9323740
NCBI-ProteinID: XP_002889136
UniProt: D7KUH8
LinkDB All DBs
Position
Unknown
AA seq 1766 aa AA seqDB search
MDCKENGIRNASACDIDANSLASNLAMDINEDFYEKLSSCGHNIDSVSSLETPQVASVGK
HTIEGQGKCFIEIEQMGDGNSNSEEDAGNTDDGLYVCYNADDTRKQGVVSGGLEQTHEVI
CDADLLVNCNKLDDGKESQDTNLSLVSIVSGSMQEKGAPQAKEDEDCGGTTLPIGGNGID
NESTFVNDAPEQFKSLETTKQRKPDEVDSGGISYTFDDGGKEGKNEPSSDQDNGSSDDIS
LIQSFSFPDSLLDSSVFGCSATENYLEDASAIEGNVPIVVSPSLAITEMLNNHDGGLCSY
DLNDITVTETINPELKLVHEDELDTDLSEKNEKMLKNLVGDSSSESAVAALSMNNGMAAD
LRAENFSQISPIDDKSFCMEANSPITDSSLIWNFPLNFGNGGNEVCNPDNAVEPLRIIDD
NGRIGGEVASASGTNFCETGLSSSRRKTRDGKQCKVAQTKMSARHPRKSTRKKQSERNLE
SIFKCSKQKRSSLLKTSRSFEWGLPSKTTEIFLQSKNIPYDGPPHHEPQRPQGNLNNGQH
NRSSHNGYVEGANRNIQASSGSCLRLKVKFGKSGGQNPLNITVSKVSGNSLPANGIVKAG
TCLELLGSANFAEDKPQTVETREDLVEKSNPVEKVSYLQSSDSMRDKKNNQDAAGLCRKL
GGDVLDDDPHLSSIIMVEECERATGTRSLDAETSPDSEVINSVPESIVNIEHKEGLHHGF
FTTPEDVVKKNRVVEKEDELLASKSPLENGSHLIPSAKKGKHSKSKSNGTKKGKSKISES
AKDGRKNESHEGVEQPKSLNTSIGRDDSDYLEVGRIESHKTTGALLDADIGKTSATYGTI
SSDVTNVETVVDFTIEDSYSTESAWVRCDDCFKWRRIPASVVGSIDESSRWICLNNSDKK
FADCSKSQEMSNEEINEELGIGQDEADAYDCDAAKRGKEKEQKSKRLTGKQKACFKAIKT
NQFLHRNRKSQTIDEIMVCHCKPPPDGRLGCGEECLNRMLNIECLQGTCPAGDLCSNQQF
QKRKYVKFERFQSGKKGYGLRLLEDVREGQFLIEYVGEVLDMQSYDTRQKEYACKGQKHF
YFMTLNGNEVIDAGAKGNLGRFINHSCEPNCRTEKWMVNGEICVGIFSMKDLKKGQELTF
DYNYVRVFGAAAKKCYCGSSHCRGYIGGDPLNGDVIIQSDSDEEYPELVILDDDESGEGI
LDATSRTFIDDADEQMPQNSETVNGSKDLAPDNAQSQSSVSVKLPEREIPPPLLQPTEVL
KELPSGIAVSAVQQEVPVEKKTKSTSPTSSSLSRLSSGGANTDMTTKHGSGEDKKILPRP
RPRPRMKTSRLSVSSKRDKGGILSGVNKAQIIPVNKLQQQPIKSKGSEEVSSSGRIETFE
GKLNELLDAVGGISKRRDSAKGYLKLLLLTAASRGTEGGTYCSNRDLSMILDALLKTKSK
SVLVDVINKNGIRVSCYKGNPCTGAYNQKTSLRRDGKVHRIARSFRDRWIPKHFRKPWRI
DREERSESMRSPINSRFRASQEPRYEHKSPRPAEPAASVTPSMAATPETASVSEGYSEPN
SSLPETNGRKRKSRWDQPSKTKEQRTMTISSQQTDETNGNQDVQDDLPPGFSSPCTDVPD
AITAQPQQKFLSCLPVSYGIPLSIVHQFGSPGKEDPTTWSVAPGMPFYPFPPLPPVSHGE
FFAKRNVIACSSSIRNPTYSNEILPATPVTDSTAPNRKRESSFDIGTTYFRQQKQNVPPW
LRNNGWEKTVNSPIPGNLTLEKKLNS
NT seq 5301 nt NT seq  +upstreamnt  +downstreamnt
atggattgcaaggaaaacggtattcgtaacgcttctgcgtgcgatattgatgctaactcc
ctggcctcaaatcttgcgatggacatcaatgaagatttctatgagaaactgagttcttgt
gggcacaatatagattcagtcagtagtttggagactcctcaggttgcttcagttggaaaa
catacgatagagggccaagggaagtgctttatagagattgagcagatgggagacgggaac
agtaatagtgaagaagatgctggaaacactgatgatggtctatatgtttgttacaacgct
gatgacactcggaagcagggagtggtttcaggtgggcttgaacaaactcacgaagtaatt
tgtgatgctgatttactggtaaattgcaacaagctggatgatggaaaggaaagtcaggac
acaaatctgtcccttgtatccatcgtttctgggagtatgcaagagaaaggagctcctcag
gctaaagaagatgaagattgtggtggcacaacattgcctatagggggcaatggaatagat
aatgaatcaacttttgtgaatgatgcaccagaacaattcaagtctttggaaaccacaaag
cagagaaaacctgatgaagttgatagtggtggtattagttatacgtttgatgatggaggt
aaggaagggaaaaatgaaccatcgagtgatcaagataatggttcttctgatgatatatct
ctcattcagagtttttcgtttccagattcgctattggactctagtgtatttggctgcagc
gccacagaaaattatttggaggatgcaagtgctattgaaggcaatgtgcctattgtggta
tccccttcattagctatcacagaaatgttaaataatcatgacggtggcctatgttcatat
gatcttaacgatatcacagtcacagagacaatcaatccagagttgaagttggtacatgag
gatgagcttgacactgatctttccgagaagaatgaaaagatgctaaaaaaccttgttggg
gattcatcaagtgaaagtgccgtggccgctttaagtatgaataatggtatggctgctgat
ctgagagctgaaaatttcagtcagatttcacccatagacgacaaatctttttgtatggaa
gccaattcccctattactgactcttctttgatatggaattttccattgaactttggaaat
ggaggcaacgaagtctgtaatcctgacaatgcagttgagccactcagaataatagacgac
aatggcagaataggtggtgaagttgcttctgcatcagggactaatttttgtgaaactggc
ttgtcttcttcccgaaggaagacccgagatggtaaacaatgtaaagtggcgcagacaaaa
atgagtgctcgccatccaagaaaatccactagaaagaaacaatcagaaagaaaccttgaa
tctattttcaagtgttcaaaacagaaaaggagctctcttttaaaaacaagccgttcattt
gagtggggattaccaagcaagaccactgaaatcttcttacagagcaaaaatattccctat
gatggacctccgcatcatgaaccacagagacctcagggcaatcttaataatggacagcat
aataggagttctcataacggatatgttgaaggagctaacagaaacatccaagcatcaagt
ggctcttgccttcgtttgaaagttaaatttggtaaatcaggtggccaaaatcctttgaac
attacagtctctaaggtcagtggtaactctttgcctgctaatggtattgttaaagcagga
acatgtttagaattgctaggatcagcaaattttgctgaggataaaccgcaaactgtggaa
acaagagaggacttggtagagaaaagcaaccctgtggagaaagtttcatatctgcagtca
tctgattctatgagggataagaaaaataatcaagacgctgcgggtttatgtaggaagctg
ggtggtgatgttttagatgatgacccacatctttcctctattataatggttgaagagtgc
gagagggccactggaacacggtccctggacgctgaaacttcaccagattctgaagttatc
aactctgtgcctgaatccattgtcaatattgaacataaagagggtctgcatcatggtttt
ttcaccactccagaagatgtggtcaagaagaacagagtagtagaaaaagaagatgaattg
ctggcttcaaaatctcctttggaaaatggttcacatctaattcccagtgcaaaaaaaggt
aaacattccaagtctaaaagtaatggaacaaagaaagggaaatccaagatttccgaatct
gccaaagacgggagaaaaaatgaatcacatgagggggtagagcaacccaaatccctgaat
accagtattggaagggatgatagtgattatcttgaagtagggagaatagagtctcacaaa
acaacaggtgcccttctagatgctgatattgggaaaaccagtgccacttatggtaccata
tcatcagatgtgaccaatgtggaaacggttgtggattttactattgaagatagctattcc
acagagagtgcctgggttcgatgtgatgattgctttaaatggcgacgaatacctgcttct
gttgtaggatcaattgacgagagctccagatggatctgtttgaacaactcagataaaaaa
tttgcggattgctcaaaatctcaagagatgtcaaatgaagaaattaatgaagagttggga
ataggacaggatgaagcagatgcatatgattgtgatgcggctaaaagagggaaagaaaag
gaacaaaagagcaagcgattgacaggtaagcaaaaggcgtgcttcaaggctataaaaaca
aaccagtttcttcatcgcaatcgtaaatctcaaacaattgatgagataatggtttgtcac
tgcaaaccaccacctgatggtaggttgggttgtggagaagaatgcctcaatagaatgctt
aacattgaatgtcttcaaggtacctgcccagctggcgatttgtgctcaaatcagcagttt
caaaaacggaagtatgttaagtttgagagattccaatccggtaagaagggttatggcctg
agattgctcgaggatgtacgagaggggcaattccttattgaatatgttggagaggtgctt
gatatgcaatcctatgatactcgccaaaaagaatatgcttgcaagggtcagaaacatttc
tatttcatgacactaaatgggaatgaggtaatagatgctggtgcaaagggaaacctaggg
cgtttcattaaccatagctgtgaaccaaactgccgtactgaaaagtggatggtgaatggt
gaaatttgcgttggaatattctccatgaaagaccttaagaagggtcaagagttgacattt
gactacaactatgtgagggtttttggtgctgccgccaaaaagtgctattgtgggtcatcg
cattgcagagggtatattgggggagatcctctgaatggtgatgtaattattcaaagtgat
tcagatgaagagtatcctgaacttgtgatccttgatgatgatgaaagtggagaaggaatc
ttagatgcaacatctaggaccttcattgatgacgctgacgagcaaatgccacagaactct
gaaacggttaatggttccaaggaccttgctcctgataatgcccaatcacagagctcagta
tctgtaaaacttcctgagagagaaattcctccacctcttcttcagccaactgaagttttg
aaggaacttccgtcaggcatagctgttagtgctgtccagcaagaggttcccgttgaaaag
aagactaaaagcacatctcccacgtccagttctcttagcagactgtcctcgggtggtgca
aatactgatatgacgacaaagcatggatcgggagaagataaaaagatacttccacggcct
cgtcctcgtcctcgtatgaaaacttctcgcttatctgtttctagtaagcgagacaaagga
ggtattttatctggtgttaacaaagcacagataataccagtcaataagttacaacagcag
cctatcaaatctaaaggatcagaggaagtttcttccagcgggcgtattgaaacatttgaa
gggaaactgaacgagttactagatgccgtaggagggataagcaagcggagggattcagca
aaaggctacttgaaacttctgctgctcactgccgcttcccgaggcacggaaggaggaacc
tattgcagcaatcgagatctttcaatgattcttgatgcccttttgaagacaaagtcaaaa
tctgttttagttgacgtaatcaacaagaatggtattagagtatcttgctacaagggaaat
ccttgcactggagcatataatcagaagacctccttgcgtagggatggaaaggttcatcga
attgcacggagcttccgagacagatggatacctaaacattttagaaaaccttggcgcatc
gacagggaggagagatcggagtctatgaggtcacctataaacagcaggttcagagcttca
caagaacctcgatatgaacataagtccccaagacctgcagaaccagctgcgtctgtcaca
ccatcaatggctgcaactcctgaaacagcatctgtatctgagggatattcagaacctaat
tccagtcttcctgaaacaaatggacgcaagcgcaaaagcagatgggaccagccgtctaag
acaaaagaacaaagaaccatgactatctcgtctcaacaaacagatgaaactaatggtaat
caggatgtccaagatgaccttccacccgggttttcatcaccctgcacagatgtgcctgat
gcgataactgcacagccgcaacaaaagttcctttcttgcttaccagtttcctatgggatc
ccacttagcattgttcatcaatttggttcacccggcaaagaggacccgaccacctggtct
gttgctcctgggatgccgttctatccatttccacctctaccgccagtgtctcatggtgag
tttttcgctaagagaaatgtaatagcctgttcctcctccattcgaaacccgacttactcc
aatgagatcttaccggctacacctgtgactgactcaactgctccaaaccgaaagagagag
agttcatttgatataggaacaacttactttcggcaacagaaacagaacgttcctccatgg
ttgcggaacaacgggtgggagaaaacagtaaacagccctatacctgggaatctaacttta
gagaagaagctcaacagttaa

DBGET integrated database retrieval system