KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_478367Help
Entry
ARALYDRAFT_478367 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00564  Glycerophospholipid metabolism
aly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    ARALYDRAFT_478367
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     ARALYDRAFT_478367
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO DAO_C FAD_binding_2 FAD_oxidored FAD_binding_3 GIDA Pyr_redox_2 HI0933_like Pyr_redox NAD_binding_8 AAA_30 3HCDH_N DUF4179
Motif
Other DBs
NCBI-GeneID: 9320857
NCBI-ProteinID: XP_002882664
UniProt: D7L8Y0
LinkDB All DBs
Position
Unknown
AA seq 619 aa AA seqDB search
MSVASIRRLAAGAAVIAAASGGAVYLSPSVASSDKGGGPILDSLRRRIGDPTASVPSRSA
QESSLIAATASDPLDVLVIGGGATGSGVALDAATRGLRVGLVEREDFSSGTSSRSTKLIH
GGVRYLEKAVFNLDYGQLKLLIENAPHLCHALPCMTPCFDWFEVIYFWMGLKMYDLVAGP
RLLHLSRYYSAKESIELFPTLARKGKDKNLRGTVVYYDGQMNDSRLNVGLACTAALAGAA
VLNHAEVVSLITDDSTKRIIGARVRNNLTGQEFNTYAKVVVNAAGPFCDSIRKMIDEDTK
PMICPSSGVHIVLPDYYSPEGMGLIVPKTKDGRVVFMLPWLGRTVAGTTDSNTSITSLPE
PHEDEIQFILDAISDYLNIKVRRTDVLSAWSGIRPLAMDPTAKSTESISRDHVVFEENPG
LVTITGGKWTTYRSMAEDAVDAAIKSGKLSPTNECVTQKLQLLGSYGWEPSSFTTLAQQY
VRMKKTYGGKVVPGAMDTAAAKHLSHAYGSMADRVATIAQEEGLGKRLAHGHPFLEAEVA
YCARHEYCESAVDFIARRCRIAFLDTDAAARALQRVVEILASEHKWDKSRQKQELQKAKE
FLETFKSSKNAQFNDGKHN
NT seq 1860 nt NT seq  +upstreamnt  +downstreamnt
atgtctgtcgcttctattcgccgtttagccgccggagccgctgtaattgccgctgcatcc
ggtggcgctgtctatctgtctccgtcggttgcctccagcgacaaaggaggtggtccgatt
ctagattccttgaggcgtaggattggtgatcccaccgcttctgtgccgtctcgatctgct
caagagtcttctctgattgcagccactgcttctgatccgctcgatgttctcgtcattggc
ggtggagccactggttctggagtcgctctcgacgctgctacacgtggcctccgtgttggt
ttggtggagcgagaggatttctcctccgggacttcttcgcgatcaacgaagctgattcat
ggaggggttcgttacttggagaaagctgttttcaatcttgattatggacagctgaagctt
ctcatcgagaatgcgccacatctctgccatgctctgccctgtatgacaccttgttttgac
tggttcgaagttatctacttctggatgggtttgaaaatgtatgatttggtcgctggacca
cggttattgcatctgtccagatattactctgcaaaagagtctattgagctcttccccact
cttgcaaggaaagggaaagacaagaatttgaggggtactgttgtgtattatgatgggcaa
atgaatgattcacgtctgaatgtgggcttggcatgtactgccgcgttagctggtgcagcc
gttctcaaccatgccgaggttgtctctcttattacagatgattctactaagagaataatt
ggtgcccgagttcgtaacaatctcacaggccaagaatttaacacctatgcaaaagtagtt
gttaatgcggcaggaccgttctgtgattccattagaaaaatgattgatgaagatacaaaa
ccaatgatttgtccaagcagcggtgtacacatcgtgctgcctgattactattctcctgaa
gggatggggttgatagttcctaaaactaaggatggtcgcgttgtgtttatgttaccatgg
ttgggaagaacagtagcaggcactacagactctaacacttcaatcacttcacttccagaa
cctcatgaagatgagattcaatttatactggatgcaatcagcgactatcttaacattaag
gttcgacgtactgatgttctttcggcttggagtggtatccgtccgttggccatggatcca
acagccaagagcacagagagtatctccagagaccacgttgtcttcgaggaaaatcctggt
ctggttacaatcacgggtggaaaatggacaacttatcgaagcatggcggaagatgcagtt
gatgcagcaatcaaatcgggaaaacttagtccaaccaatgaatgtgtaacgcagaaacta
cagcttctgggttcttatggatgggaaccatcttccttcacaactcttgcacagcaatac
gtgcgcatgaagaaaacctacggtggtaaagtggttcctggagcaatggacacagctgct
gcaaagcatttgtctcatgcctatggttcaatggctgaccgagttgccaccatagctcag
gaggagggtttggggaaacggttggcgcacgggcatccgtttttggaagccgaggttgct
tactgtgcaaggcacgagtactgcgaatcagcggttgatttcatagcaaggagatgtaga
atcgcgttcttggacactgatgcagcggctcgggcgttacagcgtgtggtggagattcta
gcaagtgaacacaagtgggacaagtcgaggcagaagcaagagttgcaaaaggctaaagag
tttcttgaaactttcaagtcttccaaaaacgcacagtttaacgatggcaagcacaactaa

DBGET integrated database retrieval system