KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_480752Help
Entry
ARALYDRAFT_480752 CDS       T01578                                 

Gene name
SDH1-2
Definition
(RefSeq) succinate dehydrogenase 1-2
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00020  Citrate cycle (TCA cycle)
aly00190  Oxidative phosphorylation
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ARALYDRAFT_480752 (SDH1-2)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    ARALYDRAFT_480752 (SDH1-2)
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     ARALYDRAFT_480752 (SDH1-2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 Thi4 GIDA FAD_binding_3 DAO HI0933_like
Motif
Other DBs
NCBI-GeneID: 9320201
NCBI-ProteinID: XP_002886171
UniProt: D7L067
LinkDB All DBs
Position
Unknown
AA seq 631 aa AA seqDB search
MWRCLRVASWRRSESNGAFITTRLSRFFSAPSSTGDRSSYTIVDHTYDAVVVGAGGAGLR
AAIGLSEHGFNTACITKLFPTRSHTVAAQGGINAALGNMSEDDWRWHMYDTVKGSDWLGD
QDAIQYMCREAPKAVIELENYGLPFSRTEEGKIYQRAFGGQSLDFGKGGQAYRCACAADR
TGHALLHTLYGQAMKHNTQFFVEYFALDLIMNSDGTCQGVIALNMEDGTLHRFHAGSTIL
ATGGYGRAYFSATSAHTCTGDGNAMVARAGLPLQDLEFVQFHPTGIYGAGCLITEGARGE
GGILRNSEGEKFMDRYAPTARDLASRDVVSRSMTMEIREGRGAGPMKDHIYLHLNHLPPE
VLKERLPGISETAAIFAGVDVTREPIPVLPTVHYNMGGIPTNYHGEVITVRGDDPNAIVP
GLMAAGEAACASVHGANRLGANSLLDIVVFGRACANRVAEIQKPGEKLKPLEKDAGAKSI
KWLDRIRNSNGSLPTSKIRLNMQRVMQNNAAVFRTQETLEEGCDLIDKTWDSFGDVKVTD
RSMIWNSDLIETMELENLLVNACITMHSAEARKESRGAHAREDFTKRDDANWMKHTLGYW
EEGNVKLEYRPVHMNTLDDEVDTFPPKPRVY
NT seq 1896 nt NT seq  +upstreamnt  +downstreamnt
atgtggcggtgccttcgagttgcatcgtggaggagatcggaatctaatggcgctttcatc
actactcgactctccagattcttctcagctccttcttcgacaggggatagatcatcgtat
acaatcgtagatcatacgtatgatgcggttgttgtaggagctggtggtgctgggctaaga
gcagcaataggattatcagaacatggttttaacacagcttgtatcaccaagctttttcca
actcgttcccatactgttgcagctcagggaggtataaatgctgcgttgggtaatatgagt
gaagatgactggagatggcatatgtatgatactgtcaagggaagtgattggttaggtgat
caagatgcaattcagtatatgtgcagggaagcaccaaaagctgtgattgagcttgagaat
tacggattgccattttctcgaacagaagagggaaaaatatatcaacgagcttttggtggc
cagagtcttgattttggaaaaggtggtcaagcataccgttgcgcatgtgctgctgaccgc
actggacatgctctgttacatactctgtatggccaagcaatgaaacacaacactcaattc
tttgtggaatactttgccttggatttgataatgaacagtgatggaacctgtcaaggagtc
attgcactgaacatggaagatggtactttacatcgtttccatgctggttctacgatattg
gctaccgggggctatgggagagcttatttttctgcaacttcagcacatacgtgcacagga
gatggaaatgctatggttgcacgagccgggctaccgctgcaggatttggagtttgttcag
tttcatcctactggtatatatggagccggatgtctcatcactgaaggagctagaggtgaa
ggaggaattctcagaaacagtgaaggtgagaaattcatggaccggtatgctcccacggct
agagatcttgcttcaagagatgtcgtttcaagatcgatgactatggaaatccgagaaggc
cgtggtgcaggacctatgaaggatcacatataccttcacttaaaccatctaccaccagaa
gtgcttaaagagaggcttcctggtatatctgaaactgcggctattttcgcgggtgtcgat
gttacaagagagccaattcctgtattgcctactgtgcattataatatgggtggtattccc
acaaactaccatggagaggtaattactgttagaggtgatgatccaaatgctatagttccg
ggactaatggctgcaggagaagcagcttgtgcatctgttcatggtgctaatagacttggt
gcaaattcacttcttgacattgttgtttttggaagagcttgtgcaaacagagttgcagag
attcaaaaaccaggcgagaaactgaaacctctagagaaggatgcgggtgcgaagagtatc
aaatggttggaccgaataagaaactcaaatgggtcgctaccgacttctaaaatccgctta
aacatgcaaagagtaatgcaaaacaatgctgctgtctttcgtacacaagaaacactagag
gaaggttgtgatttgatcgataagacgtgggacagttttggtgatgtcaaagtaacggat
cggagtatgatatggaactctgatttgatagaaactatggagttagagaatcttttggtt
aatgcgtgcataacaatgcattctgctgaggctaggaaggaaagtcgaggagcacatgct
cgtgaggatttcacgaaacgagacgatgcaaattggatgaagcacacattggggtattgg
gaagaagggaatgtgaaattggagtatagaccagtgcatatgaatacattggatgatgag
gttgacacttttcctcctaaacctcgtgtttattga

DBGET integrated database retrieval system