KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_481208Help
Entry
ARALYDRAFT_481208 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K11430  histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    ARALYDRAFT_481208
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:aly03036]
    ARALYDRAFT_481208
Enzymes [BR:aly01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     ARALYDRAFT_481208
Chromosome and associated proteins [BR:aly03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     ARALYDRAFT_481208
   Polycomb group proteins
    PRC2-EZH2 complex
     ARALYDRAFT_481208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SET preSET_CXC TCR
Motif
Other DBs
NCBI-GeneID: 9316563
NCBI-ProteinID: XP_002878682
UniProt: D7LFA7
LinkDB All DBs
Position
Unknown
AA seq 900 aa AA seqDB search
MASEASPSSSATRSEPPKDSTTEEVRGPAAKEVSEVIESLKKKLAADRCISIKKRIDENN
KNLCGITQSFMRSSMERGSGCKDGSNLLVKRQRDSPGMKSGIDESNNNHRFVEDGPANSG
MVQGSSVPVKISLRPIKMPDIKRLSPYTTWVFLDRNQRMTEDQSVVGRRRIYYDQTGGEA
LICSDSEEEAIDDEEEKRDFLEPEDYIIRMTLEQLGLSDSVLEELANFLSRSSSEIKARY
GVLIKEKEVSESGDNQAESSLFNKDMEGALDSFDNLFCRRCLVFDCRLHGCSQDLIFPAE
KPAPWCPPVDENLTCGANCYKTLLKSEKIRGYGTIEDKTGTSSDGAGTKSTSNKLNGRKP
KTFPGESASSNEKCTPETSDSENGLQQDTNSDKLSSSPKVKGSGRRGGRKRNNNRVAERV
PRKTQKRQKKTDASDSDSIASGSCSPSNANHKDNEDATSSSQKHVKSGNSGKSRKNGTPA
EDSKNPVKDDDPVCQSDKIASELDAPCSDESLRKEEFVGENVCRARLATNKLWRPLEKSL
FDKGVEIFGMNSCLIARNLLSGFKSCWEVFQYMTCSENKASFFGGDALNPDGSSKFDING
NMVNNLVRRRSRFLRRRGKVRRLKYTWKSAAYHSIRKRITERKDQPCRQFNPCNCKIACG
KECPCLLNGTCCEKYCGCPKSCKNRFRGCHCAKSQCRSRQCPCFAADRECDPDVCRNCWV
IGGDGSLGVPSQRGDNYECRNMKLLLKQQQRVLLGISDVSGWGAFLKNSVSKHEYLGEYT
GELISHKEADKRGKIYDRENSSFLFNLNDQFVLDAYRKGDKLKFANHSPEPNCYAKVIMV
AGDHRVGIFAKERILAGEELFYDYRYEPDRAPAWAKKPEAPGSKKDENVTPSVGRPKKLA
NT seq 2703 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcagaagcttcgccttcttcttccgcgaccagatcggagccacccaaagactct
actacggaggaggtgagaggtccagctgctaaggaagtatcagaagtaatagaatcgcta
aagaagaaacttgcagctgataggtgtatatcaataaagaaaaggattgatgaaaacaat
aagaatttgtgtggtattactcaaagctttatgaggtcgtccatggaaagaggaagtggt
tgtaaagatggtagtaatcttttagttaagaggcaaagagattcgcccgggatgaaaagc
ggtatcgatgaaagtaataataaccacagattcgttgaagatggacctgccaattctgga
atggttcaaggatctagtgtccctgttaagatttccttacgccctatcaaaatgcctgat
atcaaacgtttgtcaccttataccacatgggtttttctggacagaaatcaaagaatgact
gaagaccagtctgtagtgggtcgaaggagaatttattatgatcaaactggcggggaagcg
ctcatctgcagtgatagtgaagaggaggcgattgacgatgaagaagaaaaaagagatttt
ttggagcctgaagattatattattcgcatgacccttgagcaactaggtctttcagactca
gtcctggaggaactagcaaatttcttgtctagaagttctagtgaaatcaaggcaagatat
ggagtgcttattaaggaaaaagaagtatccgagagtggcgataatcaagcagagagctcc
cttttcaacaaagatatggaaggagcattagattctttcgataacctgttttgccgtaga
tgccttgtatttgattgccggctgcacgggtgttcacaggatcttatttttcctgctgag
aaaccagctccatggtgtcctcctgtagatgaaaatctaacctgtggtgcaaactgctat
aaaacgcttctcaagtctgaaaaaattcggggatatggcaccattgaagataaaactggc
acttcatcagatggtgcaggtactaaatccacatccaacaaacttaatggaagaaaaccc
aagaccttcccaggtgaaagtgcatcctctaatgaaaagtgcacaccagaaacaagtgac
tcagagaacggactacagcaggataccaattctgataaactttcatcatcaccaaaggtg
aaaggtagtgggagacgtggaggtcgtaagaggaacaacaaccgagtcgctgagcgagtt
cctcgtaagactcagaagaggcagaagaagacagacgcctcagatagtgattccatcgcc
agtggaagttgttcacccagcaatgcaaaccataaagataatgaagatgctacttcctct
tctcagaagcatgtaaaatctgggaactctgggaagtcaaggaagaatggcactcctgca
gaagactccaagaatcctgtgaaggatgacgatcctgtttgccagtcagataagattgcg
tctgagcttgatgcaccgtgtagtgatgaaagtctaaggaaagaagagtttgtgggtgaa
aatgtatgtcgagcaagattggctacaaataaattgtggagaccacttgagaaaagcctt
tttgataaaggtgttgagatttttggaatgaatagctgcttgattgctagaaaccttttg
agtggtttcaagtcatgttgggaggtcttccaatatatgacttgctcggaaaataaagct
tccttctttggaggtgatgcattgaatcctgatggctcttccaagttcgatatcaatgga
aatatggttaataacctagtgaggagaaggtcaagatttctacgtaggagaggcaaagtg
cgtcgcttgaagtatacttggaagtctgctgcatatcattcaattaggaaaagaattact
gagaggaaagaccagccctgccgtcagtttaatccatgcaactgcaaaattgcttgtggg
aaggaatgtccttgtttgctaaacgggacttgctgcgagaagtactgcggttgcccaaag
agctgcaagaatcggtttagaggttgtcattgtgccaaaagtcagtgtcgaagccgtcaa
tgtccatgctttgctgcagatcgggaatgtgacccagatgtttgtaggaactgctgggtc
attggtggggatggttcgcttggggtcccaagccaaagaggcgataattatgagtgcagg
aatatgaaattgctcctgaaacaacaacaaagggtgttacttggaatatctgatgtttct
ggttggggagctttcttaaagaacagtgtaagtaagcatgaataccttggggaatacaca
ggagagctgatctcacataaagaagcagataaacgcgggaagatatatgatcgcgagaac
tcctcttttctcttcaatctaaacgatcagtttgtgcttgatgcttacaggaaaggagac
aaacttaaatttgccaaccattctcctgaacctaactgttacgcaaaggtcattatggtt
gctggagatcacagggtggggatcttcgcaaaagagaggatactggctggagaagaacta
ttttacgattaccggtatgagccagatcgagctccagcttgggccaaaaaacctgaagct
ccgggttctaagaaagacgaaaatgttacaccttctgttggtagacccaagaagcttgct
tag

DBGET integrated database retrieval system