KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_484749Help
Entry
ARALYDRAFT_484749 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF4576 TRAP_alpha
Motif
Other DBs
NCBI-GeneID: 9311624
NCBI-ProteinID: XP_002875556
UniProt: D7LP75
LinkDB All DBs
Position
Unknown
AA seq 111 aa AA seqDB search
MRPTPVEIWKSPVPYLFGGLFLLVLLIALALLSLVCTHQKSPSSSSNNNPIDEEDDVGDK
EAKPITSEYLPKIVVILAGDNKPTCLAVPVVVPPPSSICRCNCDNVTFVPA
NT seq 336 nt NT seq  +upstreamnt  +downstreamnt
atgaggccgacaccagtagaaatctggaagtcaccagtaccatatctctttggtgggctc
tttttgcttgttttgcttatagctttggcattactttcattggtctgcacacaccaaaaa
tctccttcttcttcaagcaataacaatcctatagatgaagaagacgacgtcggggacaag
gaagctaagcctattacaagtgagtacttacctaagatcgtcgtgattttggccggagac
aataaacctacttgcttggctgttccagtcgtggttcctccgccttcttccatttgtcgt
tgtaactgtgacaatgttacttttgtcccagcctaa

DBGET integrated database retrieval system