KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_485161Help
Entry
ARALYDRAFT_485161 CDS       T01578                                 

Definition
(RefSeq) ALDH2B4
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00010  Glycolysis / Gluconeogenesis
aly00053  Ascorbate and aldarate metabolism
aly00071  Fatty acid degradation
aly00280  Valine, leucine and isoleucine degradation
aly00310  Lysine degradation
aly00330  Arginine and proline metabolism
aly00340  Histidine metabolism
aly00380  Tryptophan metabolism
aly00410  beta-Alanine metabolism
aly00561  Glycerolipid metabolism
aly00620  Pyruvate metabolism
aly00903  Limonene and pinene degradation
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_485161
   00053 Ascorbate and aldarate metabolism
    ARALYDRAFT_485161
   00620 Pyruvate metabolism
    ARALYDRAFT_485161
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ARALYDRAFT_485161
   00561 Glycerolipid metabolism
    ARALYDRAFT_485161
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ARALYDRAFT_485161
   00310 Lysine degradation
    ARALYDRAFT_485161
   00330 Arginine and proline metabolism
    ARALYDRAFT_485161
   00340 Histidine metabolism
    ARALYDRAFT_485161
   00380 Tryptophan metabolism
    ARALYDRAFT_485161
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ARALYDRAFT_485161
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ARALYDRAFT_485161
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     ARALYDRAFT_485161
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldedh AAA_25
Motif
Other DBs
NCBI-GeneID: 9313658
NCBI-ProteinID: XP_002877590
UniProt: D7LRH8
LinkDB All DBs
Position
Unknown
AA seq 537 aa AA seqDB search
MAARRVSSLLSRSLSASSPLLFRSQGRNCYNGGILRRFGTSSAAEEIINPSVQVSHTQLL
INGNFVDSASGKTFPTLDPRTGEVIAHVAEGDAEDINRAVKAARKAFDEGPWPKMSAYER
SRVMLRFADLVEKHSEELASLETWDNGKPYQQSKTVEIPMFARLFRYYAGWADKIHGLTV
PADGNYHVQTLHEPIGVAGQIIPWNFPLLMFAWKVGPALACGNTIVLKTAEQTPLTAFYA
GKLLLEAGLPPGVLNIVSGFGATAGAALASHMDVDKLAFTGSTDTGKVILGLAANSNLKP
VTLELGGKSPFIVFEDADIDKAVELAHFALFFNQGQCCCAGSRTFVHEKVYDEFVEKSKA
RALKRVVGDPFRKGIEQGPQIDSKQFEKVMKYIRSGVESNATLECGGDQIGDKGYFIQPT
VFSNVKDDMLIAQDEIFGPVQSILKFSDVDEVIKRANETRYGLAAGVFTKSLDTANRVSR
ALKAGTVWVNCFDVFDAAIPFGGYKMSGNGREKGIYSLSNYLQIKAVVTALNKPAWI
NT seq 1614 nt NT seq  +upstreamnt  +downstreamnt
atggcggctcgtagagtgtcttctcttttatctcgatctttatcagcttcctctccctta
ctgtttcgttctcaagggagaaattgttacaatggagggatcttaaggagatttggaacc
tcttctgctgctgaggaaatcattaacccttctgttcaagtttctcacacacagcttctc
ataaatgggaacttcgttgactctgcttctggtaagacgtttccgactcttgatccgcga
acaggcgaagtcattgcgcatgtagctgaaggcgatgctgaagatatcaatcgagcggtg
aaagctgcaaggaaggcctttgatgaaggaccttggcctaaaatgagtgcttatgaaagg
tcaagagtaatgctgaggtttgcagatttggttgagaaacacagcgaggagctcgcgtct
ctagagacatgggacaatggcaagccttaccaacaatccaagaccgtagagattccaatg
tttgcaagattgttccgttactatgccggatgggcggataagattcatggactaacagtt
ccagctgatggaaactatcatgttcagacattgcatgaaccgataggtgttgctggacag
atcattccgtggaatttcccgcttttgatgtttgcttggaaagttggtcctgctcttgct
tgtggtaacaccattgtccttaaaaccgctgagcaaacacctctcacggctttctatgcc
ggcaaacttttgcttgaagcgggtcttcctcctggtgttctgaatatagtttctggattc
ggtgcaacagcaggtgctgccctcgcgagtcacatggatgtggacaagcttgcttttaca
ggatcgactgatacaggcaaagttatacttggattggctgctaacagcaaccttaagccg
gtaactctggaacttggagggaaatcaccgttcatcgtattcgaagatgctgatatcgat
aaagctgtagagcttgcacactttgccctcttcttcaaccaggggcaatgttgctgcgcg
gggtctcggacatttgttcatgagaaagtgtatgatgagtttgttgagaaatcaaaggca
cgcgcattgaaacgtgtggttggtgatcctttcaggaaaggcattgaacagggtcctcag
attgattcgaagcaatttgagaaagtgatgaagtacataaggtcaggtgtcgaaagcaat
gctactcttgaatgtggtggtgatcagattggagacaaaggttacttcatccaacctact
gtcttctctaatgttaaggatgacatgcttatcgctcaagacgagattttcggtccagtc
caatcaatcttgaaattcagtgatgtggatgaggtgataaagagggcgaacgagacgagg
tacgggctagccgcaggggttttcacaaagagtttggacaccgcaaacagggtttcgagg
gctttgaaagctggtaccgtttgggttaactgcttcgacgtctttgacgcagccattcct
ttcggtggttacaagatgagtggcaatgggagagagaaaggcatatacagcctcagtaat
tacttgcagatcaaggcagtcgtcactgctcttaataagcctgcctggatctga

DBGET integrated database retrieval system