KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_492338Help
Entry
ARALYDRAFT_492338 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00500  Starch and sucrose metabolism
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    ARALYDRAFT_492338
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     ARALYDRAFT_492338
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Alpha-amyl_C2 Alpha-amylase Glyco_hydro_70
Motif
Other DBs
NCBI-GeneID: 9303703
NCBI-ProteinID: XP_002867631
UniProt: D7MGK5
LinkDB All DBs
Position
Unknown
AA seq 423 aa AA seqDB search
MTSLHTLLFTSLLFFIVFPAFTFSSTLLFQSFNWESWKKDGGFYNSLHNSIDDIANAGVT
HLWLPPPSQSVAPEGYLPGKLYDLNSSKYGSEAELKSLIKALNQKGIKSLADIVINHRTA
ERKDDKCGYCYFEGGTSDDRLDWDPSFVCRNDPKFPGTGNLDTGGDFDGAPDIDHLNPRV
QKELSEWMNWLKSEIGFHGWRFDYVRGYASSVTKLYVQNTSPDFAVGENWNDMKYGGDGK
LDYDQNEHRSGLKQWIEEAGGGVLTAFDFTTKGILQSAVKGELWRLKDSQGKPPGLIGIN
PGNAVTFIDNHDTFRTWTFPSDKVLLGYVYILTHPGIPCIFYNHYIEWGLKESISKLVAI
RNKNGIGNTSSVTIKVAESDLYVANIDDKVIMKIGPKQDVGTLVPSNFALAYSGLDFAVW
EKK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgacatctctccatacgttactcttcacttctcttcttttcttcatcgtcttcccagcc
ttcacgttttcctccaccttattgtttcagagtttcaattgggaatcatggaagaaagat
ggaggattctacaattctctccacaactccatcgacgacatagccaacgctggagtcact
catctttggcttcctcctccttctcaatccgttgctcctgaaggttacttaccgggaaag
ctatacgatctaaacagctccaaatacggttctgaagctgaactgaaatcgttaatcaaa
gcgttgaaccaaaaaggaataaaatcattggctgatatagtgattaaccacagaacagct
gagaggaaagacgataaatgcgggtactgttacttcgaaggtgggacttccgatgatcgt
cttgattgggatccttccttcgtctgccgcaatgaccctaagtttcccggtaccggaaac
ctcgacaccggaggagattttgatggagcgcctgacatcgaccaccttaaccctagagtt
cagaaagagttgtcggaatggatgaattggcttaaatctgaaataggattccatggttgg
agatttgattatgttcgaggttatgcatcttccgtcaccaaactatatgttcagaatact
tcaccggattttgcggtgggtgagaactggaacgatatgaagtatggaggagacgggaaa
ctagactatgatcaaaacgagcatcggtcgggtctcaaacagtggatcgaggaagcgggt
ggtggtgtgttgacagcttttgatttcaccactaaagggatcttacagtctgctgttaaa
ggtgagctttggagactaaaggactcgcagggaaaaccgcctggtctgatcggaatcaat
cccggaaacgcggtcactttcatagacaaccatgacactttcagaacgtggactttccct
tctgataaagtcttgcttggatacgtttatattctcactcatccgggaattccttgcatt
ttttataatcattacatagaatggggactaaaagagagcatctccaagctggtggcgatc
aggaacaaaaatggcattggtaacacaagctctgttacgatcaaagtggcggagtcggat
ctctacgtggctaatattgatgataaagttatcatgaagattggaccaaaacaggatgtg
ggaacacttgttccttctaattttgcgttagcttattcaggccttgactttgctgtctgg
gagaagaagtaa

DBGET integrated database retrieval system