KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_888118Help
Entry
ARALYDRAFT_888118 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:aly00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    ARALYDRAFT_888118
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     ARALYDRAFT_888118
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 9328537
NCBI-ProteinID: XP_002889716
UniProt: D7KIV8
LinkDB All DBs
Position
Unknown
AA seq 152 aa AA seqDB search
MAKGVAVLNSSEGVKGTIFFTQEGDGVTTVTGTVSGLKPGLHGFHVHALGDTTNGCMSTG
PHFNPDGKTHGAPEDANRHAGDLGNITVGDDGTATFTITDTQIPLTGPNSIVGRAVVVHA
DPDDLGKGGHELSLATGNAGGRVACGIIGLQG
NT seq 459 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaaggagttgcagttttgaacagcagcgagggtgttaaggggactatcttcttc
acccaggaaggagatggtgtgaccactgtgactggaacagtttctggccttaagcctggt
cttcatggtttccatgtccatgctcttggtgacaccactaacggttgcatgtctactggt
ccacatttcaaccctgatggtaaaacacacggtgcccctgaggatgctaatcgccatgct
ggtgatctaggaaatatcactgttggagacgatggaactgccaccttcacaatcactgac
acccagattcctcttactggaccaaactctattgttggaagggctgttgttgtccacgca
gaccctgatgatctcgggaagggaggccatgaactcagcctggctactggaaatgcaggt
ggccgtgttgcttgcggcatcattggtcttcagggctaa

DBGET integrated database retrieval system