KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_898127Help
Entry
ARALYDRAFT_898127 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00250  Alanine, aspartate and glutamate metabolism
aly00410  beta-Alanine metabolism
aly00430  Taurine and hypotaurine metabolism
aly00650  Butanoate metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
Module
aly_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ARALYDRAFT_898127
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    ARALYDRAFT_898127
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ARALYDRAFT_898127
   00430 Taurine and hypotaurine metabolism
    ARALYDRAFT_898127
Enzymes [BR:aly01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     ARALYDRAFT_898127
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 DUF4255
Motif
Other DBs
NCBI-GeneID: 9319152
NCBI-ProteinID: XP_002885227
UniProt: D7L7C7
LinkDB All DBs
Position
Unknown
AA seq 493 aa AA seqDB search
MVLATNSDSEEHLHSTFASRYVRAVVPRFKMPDHCMPKDAAYQVINDELMLDGNPRLNLA
SFVTTWMEPECDKLIMDSVNKNYVDMDEYPVTTELQNRCVNMIANLFHAPVGEGEAAIGC
GTVGSSEAIMLAGLAFKRKWQHRRRAQGLSTDKPNIVTGANVQVCWEKFARYFEVELKEV
KLSEDYYVMDPAKAVEMVDENTICVAAILGSTLTGEFEDVKLLNDLLAEKNAETGWETPI
HVDAASGGFIAPFLYPDLEWDFRLPWVKSINVSGHKYGLVYAGVGWIVWRTKDDLPEELV
FHINYLGADQPTFTLNFSKGSSQIIAQYYQFIRLGFEGYKNIMENCMDNARRLREGIEMT
GKFHILSKDIGVPLVAFSLKDSSKHTVFEIAESLRKFGWIIPAYTMPADAQHIAVLRVVI
REDFSRGLADRLITHIIQVLKEIEGLPSRIAHLAAAAAVSGDDEVKVKTAKMSLEDITKY
WKRLVEHKRNIVC
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atggtacttgcaaccaactctgactccgaagagcatttgcattccacttttgcttccaga
tatgtccgtgctgttgttcccaggttcaagatgcctgaccattgcatgcccaaagatgct
gcttatcaagtgatcaatgatgagttgatgcttgatggcaatcccaggcttaacctagcc
tcctttgtcaccacttggatggaacctgagtgtgacaaactcatcatggattctgtcaat
aagaactatgttgatatggatgaataccctgtcactaccgagctccagaaccggtgtgta
aatatgatagctaacttgttccatgctcccgttggagaaggcgaggctgctattgggtgt
ggaactgtcggttcatcagaggctataatgcttgctggtttagctttcaaaaggaaatgg
caacataggagaagagctcagggtctatctactgataagcctaacattgttactggagcc
aatgttcaggtgtgctgggagaaatttgcaaggtactttgaggtagagctcaaagaggtg
aaactaagtgaagactattacgtgatggacccagctaaagctgtagagatggtggatgag
aataccatctgtgttgcagcaattctaggatctacacttaccggagagtttgaggatgtg
aagctattgaacgatctcttagctgagaaaaacgcagagacgggttgggaaactcctatt
catgttgatgcagcaagtggaggattcattgctcctttcctctaccctgatcttgaatgg
gactttaggcttccatgggtgaagagtatcaatgtcagtggtcataagtatggacttgtg
tatgcaggagttggttggattgtctggagaacaaaagatgatttgcctgaggaacttgtc
tttcacatcaactacttaggagctgatcaacccactttcactctcaacttctcaaaaggg
tcgagccaaatcattgctcagtactatcagtttatccgactaggctttgagggatacaag
aacataatggaaaactgcatggataacgcaaggaggctaagagaaggcatagagatgaca
gggaagttccacattctgtctaaagatattggcgtgccactagtagcattctcactcaaa
gacagtagcaaacacacggtgtttgagatcgcagagtcactgagaaaattcgggtggatc
ataccggcttacactatgcctgcagatgcacagcacattgctgtgctcagagttgttatc
agagaagactttagccgaggccttgcagatagactcatcacacacatcattcaggtactg
aaagagattgaagggcttcctagccggatcgcgcatcttgctgcggctgcagcggttagt
ggtgatgatgaagttaaagtgaagactgcgaagatgtccttggaggatatcactaagtat
tggaaacgccttgtggaacacaagagaaatattgtctgttaa

DBGET integrated database retrieval system