KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_899892Help
Entry
ARALYDRAFT_899892 CDS       T01578                                 

Definition
(RefSeq) ATHXK2
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00010  Glycolysis / Gluconeogenesis
aly00051  Fructose and mannose metabolism
aly00052  Galactose metabolism
aly00500  Starch and sucrose metabolism
aly00520  Amino sugar and nucleotide sugar metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
aly01200  Carbon metabolism
Module
aly_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
aly_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_899892
   00051 Fructose and mannose metabolism
    ARALYDRAFT_899892
   00052 Galactose metabolism
    ARALYDRAFT_899892
   00500 Starch and sucrose metabolism
    ARALYDRAFT_899892
   00520 Amino sugar and nucleotide sugar metabolism
    ARALYDRAFT_899892
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    ARALYDRAFT_899892
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:aly04131]
    ARALYDRAFT_899892
Enzymes [BR:aly01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     ARALYDRAFT_899892
Membrane trafficking [BR:aly04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    ARALYDRAFT_899892
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 9322084
NCBI-ProteinID: XP_002886018
UniProt: D7L6G0
LinkDB All DBs
Position
Unknown
AA seq 502 aa AA seqDB search
MGKVAVATTVVCSVAVCAAAALIVRRRMKSSGKWARVIEILKAFEEDCATPIAKLRQVAD
AMTVEMHAGLASEGGSKLKMLISYVDNLPSGDETGFFYALDLGGTNFRVMRVLLGGKQDR
VVKREFKEESIPPHLMTGKSHELFDFIVDVLAKFVATEGEDFHLPPGRQRELGFTFSFPV
KQISLSAGTLINWTKGFSIDDAVDKDVVGELVKAMERVGLDMRVAALVNDTIGTLAGGRY
TNPDVVVAVILGTGTNAAYVERAHAIPKWHGLLPKSGEMVINMEWGNFRSSHLPLTEYDH
SLDLDSLNPGEQILEKIISGMYLGEILRRVLLKMAEEAAFFGDIVPPKLKIPFILRTPNM
SAMHSDTSPDLKVVGSKLKDILEVPNSSLKMRKVVISLCNIIASRGARLSAAGIYGILKK
IGRDATKDGEAQKSVIAMDGGLFEHYTQFSESMKSSLKELLGDEVSESVEVILSNDGSGV
GAALLAASHSQYLELEDDFETS
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgggtaaagtggctgttgctacgacggttgtgtgttcggtggcggtttgtgcggcggcg
gcgttgatagtacggcggcgaatgaaaagctcagggaaatgggcaagagtgatagagata
ttgaaagcgtttgaagaagattgtgcaacgccaattgcgaaattgagacaagtggctgat
gctatgactgtggagatgcatgctggtcttgcttctgaaggtggaagcaagcttaagatg
cttattagctacgttgataatcttccttctggggatgaaactggtttcttttatgcattg
gatctaggaggaacaaacttccgtgtaatgcgtgtgcttcttggtgggaaacaagaccgt
gttgttaaacgagaatttaaagaagaatcaattcctcctcatcttatgaccgggaaatca
catgaattattcgattttatcgttgacgttcttgccaagtttgtcgctacagaaggcgag
gactttcatctcccaccgggtagacaaagggagttaggtttcactttctcatttccggtt
aagcagatatctttgtccgctggcactctcatcaactggacaaaggggttttccattgat
gatgcagttgataaagatgttgttggagaacttgttaaagctatggaaagagttgggctg
gacatgcgtgttgcagcgcttgttaatgatacaattggaacactcgcgggtggtagatac
actaacccggatgtcgttgtcgctgttattttgggcaccggcacaaatgcagcctatgtc
gaacgtgcacatgcaattcccaaatggcatggtttgctacccaaatcaggagaaatggtg
atcaacatggagtggggaaacttcaggtcatcgcatcttccattgacagagtacgaccac
tcgctagatttggatagtttgaatcctggtgaacagattcttgagaaaatcatttccgga
atgtatctgggagaaatcttgcgtagagttcttctgaaaatggctgaagaagctgctttc
tttggcgacatcgtcccacccaagctgaaaataccattcatcttaaggaccccgaacatg
tctgctatgcacagcgatacttccccggatttgaaggttgtgggaagcaagttaaaagac
atattggaggtcccgaatagttctctgaagatgagaaaagttgtgatcagcctctgtaac
atcatcgcaagccgaggagctcgtttgtctgctgcagggatctatggaatcctcaagaaa
ataggaagagacgcaacaaaagatggagaagctcagaaatctgtaatagcaatggacggt
gggctattcgagcactacactcagttcagtgagtcgatgaagagttcattgaaagagttg
cttggagatgaagtttcagagagtgttgaagtgatactatcgaatgatggttcaggtgtt
ggagctgcattacttgctgcttctcactctcaatatctcgaacttgaagatgactttgaa
acaagttaa

DBGET integrated database retrieval system