KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_902435Help
Entry
ARALYDRAFT_902435 CDS       T01578                                 

Definition
(RefSeq) ATSWI3B
  KO
K11649  SWI/SNF related-matrix-associated actin-dependent regulator of chromatin subfamily C
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Brite
KEGG Orthology (KO) [BR:aly00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:aly03021]
    ARALYDRAFT_902435
   03036 Chromosome and associated proteins [BR:aly03036]
    ARALYDRAFT_902435
Transcription machinery [BR:aly03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    BAF/PBAF complex
     ARALYDRAFT_902435
Chromosome and associated proteins [BR:aly03036]
 Eukaryotic type
  Chromatin remodeling factors
   BAF complex
    ARALYDRAFT_902435
   PBAF complex
    ARALYDRAFT_902435
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: SWIRM Myb_DNA-binding SWIRM-assoc_1 Myb_DNA-bind_6
Motif
Other DBs
NCBI-GeneID: 9315527
NCBI-ProteinID: XP_002879460
UniProt: D7LGC1
LinkDB All DBs
Position
Unknown
AA seq 468 aa AA seqDB search
MAMKAPDSGGSGEILPNTPSLSETTSGVAAALQSPQPPSSSSDIDTIYVPSYSRWFSWTG
INDCEVRSLPEFFDSRSSSKNPKFYLYLRNSIIKQYRDDHPRKISFTDVRRTLVSDVVSI
RRVFDFLDSWGLINYTSSASAKPLKWDEKEAGKSVGDAASEPSTTVKETAKRICNGCKSI
CSIACFACDKYDLTLCARCYVRSNYRVGINSSEFKRVEISEESKIQWSEKEILLLLEAVM
HYGDDWKKVAPHVTGRTEKDCVSQFVKLPFGEQFVKESDFEDGLEAFDQIKGSAIPESEG
IDKDCSSPNKRMKLTPLADASNPIMAQAAFLSALAGTNVAEAAARAAVTALSDVDYDADK
NASGDSNRQEANGASSGETTRNDSERAWADAKSLIEKEEQEVEVAIKETVEVEMKKIRDR
IVHFEKLDLEMERSRKQLEEMKNLLFVDQLNIFFHTRKARTSEDRVEC
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atggccatgaaagctcccgattccggcggatctggggaaattcttccaaatactccctct
ctttccgaaactacgtctggagttgccgcagctttgcagtcgcctcaaccgccgtcttct
tcttccgatatcgatactatctacgtacctagctactcccgttggttttcgtggacgggc
atcaacgattgcgaggtccgttcactgccggaatttttcgattcgagatcttcatccaaa
aaccctaagttttacctctacttgaggaattcgattattaagcagtacagagacgaccat
cctcggaagattagcttcactgacgttcggagaactctcgtcagtgatgttgtctctatt
cgtcgcgtatttgatttcctagactcatgggggcttatcaactatactagctccgcctct
gctaagccgctcaagtgggacgaaaaagaggccggaaaatccgtcggagatgctgcttct
gagccatccactactgtcaaagaaactgccaagagaatctgcaatggctgcaaatcaatt
tgcagcatagcttgtttcgcctgtgataagtatgacttgacattgtgtgcgaggtgctat
gtccgtagtaactatcgagttggtattaactcctcggagtttaagcgagttgagattagt
gaggagtcaaagatacagtggtctgaaaaggaaattctgcttctgctggaagctgttatg
cactatggagatgattggaagaaggttgcaccgcatgttactggtagaaccgagaaggat
tgtgtttctcagtttgtcaagcttccgtttggggaacagtttgtaaaagagtctgacttt
gaggatggtttagaggcgtttgatcagatcaagggctctgctattcctgaatctgaagga
atagataaagactgttcttctcccaataagcggatgaaattaacgcctcttgcggatgca
agcaacccaataatggctcaggctgcttttctttcagctttggctggcacaaatgttgca
gaagcagcagctcgagcggcagtgacagctttatctgatgtagactacgacgctgacaaa
aatgccagcggagactcaaatcgacaagaggccaatggtgcttcgagtggtgaaaccact
agaaacgactctgaaagagcttgggcagatgcgaagtctctgatcgagaaggaagagcag
gaggtagaagtagcaatcaaagagactgttgaagttgagatgaagaagatccgagatagg
attgtacatttcgagaaattggatttggaaatggagagaagccggaaacaattggaggag
atgaagaatctgcttttcgttgatcaattaaacattttcttccacacaagaaaagcccgg
acatctgaagatagagtagagtgttag

DBGET integrated database retrieval system