KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_909139Help
Entry
ARALYDRAFT_909139 CDS       T01578                                 

Definition
(RefSeq) alpha-glucosidase 1
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00052  Galactose metabolism
aly00500  Starch and sucrose metabolism
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    ARALYDRAFT_909139
   00500 Starch and sucrose metabolism
    ARALYDRAFT_909139
Enzymes [BR:aly01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     ARALYDRAFT_909139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 9307561
NCBI-ProteinID: XP_002871491
UniProt: D7M4B8
LinkDB All DBs
Position
Unknown
AA seq 905 aa AA seqDB search
MSSLHWFPNFFIVFVVFFSSHGSGSSQVVLEEEEATVVGYGYVVRSVAVDSNRQVLTAKL
DLIKPSSVYAPDIKSLSLHVSLETSERLRIRITDSSQQRWEIPETVIPRAGNHSPRRFLT
EEDGGNSSENNFLADPSSDLVFTLHNTTPFGFSVSRRSSGDILFDTSPDQSDSNTYFVFK
DQFLQLSSALPENRSNLYGLGEHTKRSFKLISGDTMTLWNADIGSENPDVNLYGSHPFYM
DVRGSNGHEEAGTTHGVLLLNSNGMDVKYEGHRITYNVIGGVIDLYVFTGPSPEMVMNQY
TELIGRPAPMPYWSFGFHQCRYGYKNVSDLESVVDGYAKAGIPLEVMWTDIDYMDGYKDF
TLDPVNFPEDKMKSFVDTLHKSGQKYVLILDPGIGVDSSYGTYNRGMEVDVFIKRNGEPY
LGEVWPGKVYFPDFLNPAAATFWSNEIKMFQEILPLDGLWIDMNEISNFITSPLSSGSSL
DDPPYKINNSGDKRPINNKTVPATSIHFGNISEYDVHNLYGLLEAKATHQAVVDITGKRP
FILSRSTFVSSGKYTAHWTGDNAAKWEDLAYSIPGILNFGLFGIPMVGADICGFSHDTTE
ELCRRWIQLGAFYPFARDHSSLGTARQELYLWDSVASSARKVLGLRMRLLPHLYTLMYEA
HISGNPIARPLFFSFPRDTKTYEIDSQFLIGKNIMVSPALKQGTVAVDAYFPAGNWFDVF
NYSFAVGGDSGKHVRLDTPADHVNVHVREGSIVAMQGEALTTRDARKTPYQLLVVASRLE
NISGELFLDEGENVRMGAGGGNRDWTLVKFRCFVTGKSVVLRSEVVNPEYASKMKWSIEK
VTFVGFENVESVKTYEVRTSERLRSPRISLIKTVLDNDDPRFLSVEVSKLSLLVGKKFEM
RLRLT
NT seq 2718 nt NT seq  +upstreamnt  +downstreamnt
atgtcatctcttcactggtttcccaatttcttcatcgttttcgtcgtcttcttctcctca
catggaagcggaagctcacaagttgtactagaagaagaagaagccacagtcgttggatac
ggctacgtcgttagatcagtggccgttgattctaaccggcaagttttgacggcgaagctt
gatctgataaaaccatcgtccgtttatgcaccagatattaaatcgctaagtcttcatgtc
agcttggagacgagtgagcgtttgagaatcagaatcacagattctagtcaacaaagatgg
gagataccggaaaccgttattcctcgtgccggaaaccactctcctcgccgtttcttaacg
gaggaagacggaggaaactcgtcggagaacaatttcttagcagatccttcatcggactta
gttttcacactccacaacacgacgccgttcggtttctccgtctcccgacgctcctccggc
gatatcctcttcgacacatcgccggatcaatcagattcaaacacttacttcgtcttcaaa
gaccaattccttcaactatcttccgcgttaccggaaaacagatcgaatctgtacggtctc
ggagagcacacgaagcgatcgttcaagctaatttccggtgatacaatgactctgtggaac
gctgacatcggcagcgagaatccggatgttaacctttacggatcgcacccgttttacatg
gatgtaagaggatcaaacggccatgaagaagcagggacgactcacggcgttttgctgcta
aacagtaatggaatggatgtgaagtatgaaggacatcggattacttacaatgtgattgga
ggcgtaattgatctctatgtgttcaccggaccatcgccagagatggtgatgaatcagtac
actgagcttattggaagacctgcccctatgccttactggtcatttggatttcaccagtgt
aggtatgggtacaagaatgtttcagaccttgaatctgtagttgatggatatgcaaaagct
ggaatacctcttgaggttatgtggactgacattgattacatggatggctacaaagacttc
actttggatcccgtgaatttcccggaggacaagatgaaatcatttgtcgatacacttcac
aagagcggtcagaaatacgtgctgatcttggatcccggtattggtgtggatagctcttac
gggacctataacagaggaatggaagtggatgttttcatcaaaagaaatggtgagccttat
ctcggtgaggtttggcccggaaaagtatacttccccgacttcttgaatccagctgctgca
actttctggagcaacgaaatcaagatgttccaggagattctccctttggatggtctgtgg
attgacatgaatgagatatcaaatttcataacttcgcctctatcctctggatcttcactc
gatgatcctccttacaagatcaacaattcaggggataaaagaccgataaacaataagaca
gtacccgcaacatctatccattttggaaacattagtgaatacgatgtgcataacttgtat
gggctcttggaagctaaagccactcaccaagctgtggtggatataacaggaaagagaccg
tttattttgtcgagatccacgtttgtaagctcggggaaatacacggctcactggactggt
gataatgctgcaaaatgggaggatttggcctactcaatccctggaatcctcaattttggt
ctgtttgggattccaatggttggagctgatatctgcgggttttcacatgataccaccgag
gaattatgccgtcgatggatccagcttggagctttttacccttttgcaagagaccattcg
tcccttggtaccgccagacaagaactatacctctgggattcggttgcttcttctgcaaga
aaggttctcggtctcagaatgagactgctcccacatctctacacattgatgtacgaggct
catatcagcggcaacccaatcgcgcgaccactcttcttctcgtttcctcgagacactaaa
acctatgagatcgattcccagtttttgattggtaaaaacataatggtttctcctgcgctg
aagcaagggacggtggccgtggatgcatatttccctgctggaaactggttcgatgttttt
aactattcctttgccgttggtggagattctggcaagcacgttaggcttgatactcccgct
gatcacgtcaacgttcatgttcgagaaggtagcattgtggctatgcaaggagaggcattg
acgactagggacgccagaaagacaccgtatcagcttctagttgtagccagccggcttgag
aacatctccggtgaactgtttctcgatgagggagaaaacgtacggatgggagctggagga
ggaaaccgtgattggaccctcgtgaagttccggtgcttcgtgacaggaaaatccgtggta
ctgagatcagaagtggtgaacccagagtacgcgtcgaaaatgaaatggagcatcgagaaa
gtgacgtttgttgggttcgagaacgtagagagcgtgaaaacgtacgaggttaggacaagt
gagagattaaggagtccgagaatctctctaattaagacggttttggacaatgatgatccg
aggtttctcagtgtggaggtttctaaactgtcgttgcttgttggaaagaagttcgagatg
agattgagattgacttga

DBGET integrated database retrieval system