KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_918235Help
Entry
ARALYDRAFT_918235 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00040  Pentose and glucuronate interconversions
aly00051  Fructose and mannose metabolism
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    ARALYDRAFT_918235
   00051 Fructose and mannose metabolism
    ARALYDRAFT_918235
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     ARALYDRAFT_918235
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 PALP Methyltransf_25 UDPG_MGDP_dh_N Pyr_redox_2 TrkA_N
Motif
Other DBs
NCBI-GeneID: 9300220
NCBI-ProteinID: XP_002864144
UniProt: D7MRL0
LinkDB All DBs
Position
Unknown
AA seq 364 aa AA seqDB search
MGKGGMSHGEGSKVEEENMAAWLVGLNTLKIQPFLLPSVGPHDVRVRMKAVGICGSDVHY
LKTMRCADFVVKEPMVMGHECAGIIEEVGEEVKHLVVGDRVALEPGISCWRCNLCREGRY
NLCPEMKFFATPPVHGSLANQVVHPADLCFKLPENVSLEEGAMCEPLSVGVHACRRAEVG
PETNVLVMGAGPIGLVTMLAARAFGVPRIVIVDVDENRLAVAKQLGADGIVQVTTNLEDV
GSEVEQIQKTMGSNVDVTFDCAGFNKTMSTALAATRCGGKVCLVGMGHGIMTVPLTPAAA
REVDVVGVFRYKNTWPLCLEFLTSGKIDVKPLITHRFGFSQKEVEDAFETSARGSNAIKV
MFNL
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atggggaaaggagggatgtctcatggagaaggctcaaaggttgaagaagaaaacatggct
gcttggttggttggtctcaataccctcaagatccaaccttttcttcttccttcagttggt
cctcatgatgtgagagttaggatgaaagctgttggtatttgtggaagtgatgttcattac
ctaaagaccatgagatgtgctgattttgtggtgaaagaaccgatggtgatgggacatgaa
tgtgctgggatcattgaagaagtaggtgaagaagtgaaacatctagtggttggtgaccgt
gttgctcttgaacctgggattagttgttggagatgcaatctctgcagagaagggcgatac
aacctttgtccagagatgaagttctttgcaactccaccggttcacggctctctagccaat
caagtggtacaccctgcggatctatgctttaaattgcctgagaatgtgagtttggaggaa
ggagcaatgtgtgaaccacttagtgttggtgtccatgcttgtcgccgagctgaggttggt
cctgaaacaaacgtcttggtaatgggagctggacctattggccttgtcaccatgttggct
gctcgggctttcggtgtgcctagaattgttattgtggatgttgatgagaaccgtttagcc
gtagcaaaacagcttggtgcagatgggattgttcaagtgacaacaaacttagaggatgtt
ggttctgaggttgaacaaattcagaaaactatgggctcaaacgtcgatgtgacattcgat
tgtgcgggttttaacaaaaccatgtcgacagcattagcagccactcgatgtggcggtaaa
gtctgtcttgtcggaatgggtcacggtataatgactgtccctctcactcctgcagctgca
agggaggtagatgtggtaggtgtgttcaggtacaagaacacatggcctttgtgtcttgag
ttcctgacaagtggtaagattgatgtaaagccactcataacccacagattcggtttctct
cagaaggaagtggaagatgcctttgaaaccagtgctcgtgggagcaatgccatcaaagtt
atgttcaatctgtga

DBGET integrated database retrieval system