KEGG   Alteromonas sp. Mac2: AV940_01355Help
Entry
AV940_01355       CDS       T05899                                 

Gene name
glpD
Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
alz  Alteromonas sp. Mac2
Pathway
alz00564  Glycerophospholipid metabolism
alz01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alz00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    AV940_01355 (glpD)
Enzymes [BR:alz01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     AV940_01355 (glpD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_oxidored FAD_binding_2 Pyr_redox_2 FAD_binding_3 NAD_binding_8 TMEM240 GIDA DUF3090
Motif
Other DBs
NCBI-ProteinID: AMJ92536
LinkDB All DBs
Position
344325..345851
Genome map
AA seq 508 aa AA seqDB search
MNQNTNSTQTVDVLVVGGGVNGAGVALDAAGRGLSVALCEKGDLAGATSSSSSKLIHGGL
RYLEHYEFRLVKEALAEREVLLEKAPHIMWPLRFRLPHQKHLRPAWMIRIGLFLYDSLAK
RNVLPRSKKMSTSPTGPLVNDITTCFEYSDGWVDDARLVVLNALAAQDQGASIYTRTECI
SAEKQDKLWKVTLKDALGKTFTINAKAVVNAAGPWAVSFLDRLADTKNPNAMRMVKGSHF
IVPKLYDTEEAYILQNKDGRIVFVIPYEDDFSLVGTTDENYVGEPSQAAISEDETEYLVE
VVNTYFKTKIDESDIVHSYSGVRPLLEEKNASAQELTRDYKVELSGTESSPILLNIFGGK
ITTYRKLAEHAVDKLTSLFPKAGKAWTKDVPLPGGAFTNKEDLIKQLQHDYPWLSESLGV
RYARQYGMLCIKFLEGKNGLDSMGENFGADMYKAEVDYLIDHEWAMSLEDVIWRRTKHGL
RLNQSEQANLESYITSRVSKSVDMQQSA
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
atgaatcagaatacaaatagtacacaaaccgttgacgtattagtggttggcggcggtgta
aatggtgccggagtagcattagatgcggctggtcgcggactttcggtagcactatgtgaa
aaaggcgatcttgcaggtgcaacgtcttcgtctagcagcaagttaattcatggtggttta
cgttatttagagcattatgagttccgccttgtaaaagaagcactcgccgagcgtgaagta
ctattagaaaaagccccacatattatgtggcctttacgttttcgtttacctcatcaaaag
catcttcgtcctgcatggatgattcgtattggtttgttcttgtacgattcactagccaaa
cgcaatgtattaccgcgttcaaagaaaatgtctacgtcacctacaggcccgttggttaac
gatattacaacctgttttgaatactcagatggttgggtagatgatgctcgtttagtggta
ttaaatgcactagcggcgcaagaccaaggtgctagcatctatacacgtactgaatgtatt
agtgctgaaaaacaagataagttatggaaagtcactttaaaagacgcattagggaaaacg
tttacaattaatgctaaggctgttgtcaatgcagctggcccatgggctgtttcattccta
gatagacttgccgacaccaaaaatcctaacgcaatgcgtatggtgaagggcagtcatttc
attgtgcctaaactttacgacacagaagaagcttatattcttcaaaataaagatggccgt
attgtttttgttattccttacgaagatgatttttcactcgttggtactaccgatgagaac
tatgttggtgagccatcgcaagccgctatttctgaagatgaaactgaatatttggtcgaa
gtggtaaatacgtactttaaaacgaaaattgatgaaagcgatattgttcatagctacagt
ggcgtgcgcccattgcttgaagagaaaaatgcgtctgctcaagagctaactcgcgattat
aaagtggaactaagcggaactgagtcttcgccaatattgcttaatattttcggtggtaaa
attacgacctatagaaaacttgccgagcatgcagtagataagctaactagtttgtttcca
aaggcagggaaagcctggacgaaagatgtaccacttccaggtggcgcgttcactaataaa
gaagatttgattaaacagcttcaacacgactatccatggttatctgagtcgttaggggtt
cgctatgcgcgtcaatacggcatgttatgtattaagttccttgaaggcaaaaacggactc
gatagcatgggtgagaactttggtgccgacatgtacaaagctgaagttgactaccttatt
gatcacgaatgggcgatgtcccttgaagacgtaatttggcgccgtactaaacatggttta
cgtttaaaccaaagcgagcaagccaacctagaaagctatataacgagtcgcgtttcaaaa
agtgtcgatatgcagcaatctgcgtag

DBGET integrated database retrieval system