KEGG   Alteromonas sp. Mac2: AV940_01510Help
Entry
AV940_01510       CDS       T05899                                 

Definition
(GenBank) two-component system response regulator
  KO
K07773  two-component system, OmpR family, aerobic respiration control protein ArcA
Organism
alz  Alteromonas sp. Mac2
Pathway
alz02020  Two-component system
Brite
KEGG Orthology (KO) [BR:alz00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AV940_01510
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:alz02022]
    AV940_01510
Two-component system [BR:alz02022]
 OmpR family
  ArcB-ArcA (anoxic redox control)
   AV940_01510
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C DUF3653 RisS_PPD
Motif
Other DBs
NCBI-ProteinID: AMJ89259
LinkDB All DBs
Position
complement(380613..381320)
Genome map
AA seq 235 aa AA seqDB search
MQTPNVLIVEDEVVTRTTLKSLFEAEGYNVFEAENGDQMHDFFENHAINLVIMDINLPGK
NGLILAREVRDRKNVGLIFLTGRDNDVDRILGLEIGADDYLTKPFNPRELTIRARNLLSR
TTNSAEDDDLPSRVNFNGWILDGDSRSLISPTGKEFRLPRSEFRALHLFLSNPGKILTRE
QLIMEMTGRELRPNDRTVDVTIRRIRKHFESDPSDEELIVTIHGEGYRFCGSVDG
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgcagacgccaaatgtgttaattgttgaagatgaagtggtcacacgtaccacgctaaag
agtttattcgaagcagaagggtacaatgtatttgaagctgaaaatggtgatcaaatgcat
gacttctttgaaaatcacgcaattaatttggttattatggatattaacctgccaggtaaa
aatggcctaattttggcgcgtgaagtacgcgaccgtaaaaacgtaggtcttattttcctt
actggccgtgataacgatgtcgatcgtatcttaggtctagaaattggcgcagatgactat
ctaaccaagcctttcaatcctcgtgaactgactattcgtgcgcgtaacttgttatctcgc
accactaactcagcagaagacgatgatttaccaagccgtgtaaacttcaatggctggatt
ttggatggcgacagccgttcacttatttcaccaacaggtaaagagttccgtttaccacgc
agtgaattccgtgcattacatttattccttagcaacccaggtaaaattcttacccgtgag
cagctaattatggaaatgacaggtcgtgagcttcgccctaacgaccgtactgtagatgta
actatccgccgtattcgcaagcacttcgaatcagatccttctgatgaagagttgattgtg
accatccacggtgaaggttaccgcttctgcggctctgttgacggctaa

DBGET integrated database retrieval system