KEGG   Alteromonas sp. Mac2: AV940_02090Help
Entry
AV940_02090       CDS       T05899                                 

Gene name
aroK
Definition
(GenBank) shikimate kinase
  KO
K00891  shikimate kinase [EC:2.7.1.71]
Organism
alz  Alteromonas sp. Mac2
Pathway
alz00400  Phenylalanine, tyrosine and tryptophan biosynthesis
alz01100  Metabolic pathways
alz01110  Biosynthesis of secondary metabolites
alz01130  Biosynthesis of antibiotics
alz01230  Biosynthesis of amino acids
Module
alz_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:alz00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    AV940_02090 (aroK)
Enzymes [BR:alz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.71  shikimate kinase
     AV940_02090 (aroK)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: SKI Cytidylate_kin2 AAA_18 AAA_33 Cytidylate_kin AAA_16 AAA_24 AAA_22 ABC_tran dNK AAA_25 AAA APS_kinase TsaE Ploopntkinase3 AAA_17 AAA_29 AAA_7 RNA_helicase AAA_5 RsgA_GTPase Guanylate_kin PduV-EutP AAA_PrkA
Motif
Other DBs
NCBI-ProteinID: AMJ89362
LinkDB All DBs
Position
complement(520782..521297)
Genome map
AA seq 171 aa AA seqDB search
MAEKRNIFLVGPMGAGKSTIGRHLADELHLDFYDSDQEIERRSGADIAWIFDLEGEDGFR
AREENIINDLTDKQGIVLATGGGSIVTKAVRNRLSARGIVVYLQTTIDKQVARTQRDKRR
PLLQNDDPEQVLRDLADLRNPLYEEVADYVVDTDDQSARAVANQIISKIGL
NT seq 516 nt NT seq  +upstreamnt  +downstreamnt
atggctgaaaaacgtaatatctttttggttggcccaatgggtgctggcaaaagtaccatc
ggtagacacctggcagacgaacttcacctggatttttatgactccgatcaggaaatagag
cgccgttctggtgctgatatcgcctggatcttcgaccttgaaggcgaagatggattccgt
gcacgtgaagaaaacatcatcaatgatttaacagacaagcagggtatcgtgcttgccact
ggcggcggttcaattgtaaccaaagcagtacgtaatcgtttgtctgcacgaggcattgtt
gtttacttgcaaactacgattgataagcaagttgctcgaacacagcgcgataagcgtcgc
cctttgcttcaaaacgacgatccggagcaagtacttcgcgatctagcagatttgcgtaat
cctctttacgaagaagttgcagattatgtagttgatactgatgaccaatctgctcgcgca
gtggcaaatcagatcattagtaaaatcggtttataa

DBGET integrated database retrieval system