KEGG   Alteromonas sp. Mac2: AV940_02120Help
Entry
AV940_02120       CDS       T05899                                 

Definition
(GenBank) penicillin-sensitive transpeptidase
  KO
K05366  penicillin-binding protein 1A [EC:2.4.1.129 3.4.16.4]
Organism
alz  Alteromonas sp. Mac2
Pathway
alz00550  Peptidoglycan biosynthesis
alz01100  Metabolic pathways
alz01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:alz00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AV940_02120
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    AV940_02120
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:alz01003]
    AV940_02120
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:alz01011]
    AV940_02120
Enzymes [BR:alz01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.129  peptidoglycan glycosyltransferase
     AV940_02120
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     AV940_02120
Glycosyltransferases [BR:alz01003]
 Polysaccharide
  Bacterial polysaccharide
   AV940_02120
Peptidoglycan biosynthesis and degradation proteins [BR:alz01011]
 Peptidoglycan biosynthesis and degradation
  Glycosyltransferase/DD-Transpeptidase (Class A PBP)
   AV940_02120
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transgly Transpeptidase PCB_OB
Motif
Other DBs
NCBI-ProteinID: AMJ89368
LinkDB All DBs
Position
526247..528925
Genome map
AA seq 892 aa AA seqDB search
MKYIKPLLLFFVISGLIGCVALVGIYFYIKPNLPSVTVLKDVRLQTPMQIYTHDGKLISQ
YGVKRRIPVKLEEVPEQLVHAILATEDSRFFEHHGIDPIGIARAALSLILTGEKRQGAST
LTMQLARGFFLSREKTYIRKVKEIFIAWHMEQELSKEEILELYLNKVELGHRSFGFGAAA
QVYYGKSLNELTLAQLATIAGLPKAPSALNPITDPEASAGRRRVVLLRMLDEEYISKADF
DSAASAPITARKHGAEIEVDAPYLADIIYNEMVDIYGKDEAETGGYQVYATAGSDLQLAA
QRAVVRNLHDYDERHGYKGPLGYLWDAPSPDSQDEPVPQLSLNTDISDKLLASDWSEREM
LAALSQVPYIKPLVPAVVLSAAEQSIDVLDVNGEKRTITWEGLDWARRYITDFRQGSEPE
TASDITQPGAVIYIREQDDAWRIAQLPEVSGAFIALNPRNGAVEAVVGGYSFYQSQFNRA
TQAKRQVGSNIKPFIYSAAIDSGYTLASIINDAPINQWNAATGVAWRPQNSPAEYDGPIR
MRKALGKSKNVVSVRLLRGVGLRKAADYLTRFGFDPDDIPLDETVSLGSSSHTPLEVVRG
MSVIANGGYLVNPHFIAKVLDEHNQVLWQANPVWACDNCTKAHAPESYPESDLDSGLDNN
EVDVEALLEAQLNKDVLLAENETAEKQSAPQVITAQNAFLVGEMMRTGVRANGNWSKKTY
WLGTGWRARNILQRTDIAGKTGTTNDSRDTWFSGFQKDIVATAWVGFDNMGRQLGRATRN
QNLVNRNPEKFNWIGNALIGTEDGAKAAGPAWIRFMEYALAGKPHSPIPVPEKIVRVRID
RTSGKLTRRTDHTTLFEYFLQGTEPTSYVLDDEVVDPASQNKTTTPEPEEIF
NT seq 2679 nt NT seq  +upstreamnt  +downstreamnt
gtgaagtacattaaaccgttattattattctttgtcatctccggccttattggttgtgtc
gcgcttgttggtatttacttttatatcaaacctaacctaccaagcgtcactgtacttaag
gatgttagactccaaacgcccatgcagatatatacccatgatggaaaattaatttcccag
tatggggttaaacggcggatacccgtaaaacttgaggaagtgcctgaacaattagtccac
gcgatattggcgacagaggacagtcgcttctttgaacatcacggtattgaccctatcggt
atcgcccgtgcagcgttgagcttaattcttacgggtgaaaaaaggcaaggtgcgagcaca
ttaaccatgcagcttgctcgaggcttctttttaagtcgagaaaaaacatatattcgtaag
gtaaaagagatatttatcgcttggcacatggagcaggaactcagtaaagaagagatactt
gaactttatttgaataaagttgagctaggtcatcgttcgtttggcttcggtgctgccgcc
caagtatattacggtaaatctcttaatgaacttacattggcacaacttgctactattgct
ggccttccaaaagcgccttcagcactaaaccctattactgatcctgaagcatccgcaggt
cgccgccgcgtggtgttgctgcgtatgcttgatgaagaatacatatctaaagcagacttt
gatagtgcggcaagcgcgcctataactgcgcgtaagcatggtgcagaaattgaagtggat
gcgccatatttggccgatatcatctataacgaaatggtcgacatttacggtaaagatgaa
gctgaaaccggtggctatcaagtttatgcgaccgcaggttccgacttgcagcttgctgct
cagcgggcggtggtcaggaatcttcacgactatgatgagcgtcatggttacaaaggacca
ctgggctatttgtgggatgccccatcgccagatagccaagatgagccagtgccgcagctt
tctttaaataccgatatcagtgataagttgcttgccagtgattggagcgagcgcgaaatg
cttgctgcgctgtcacaagtgccgtacataaagcctcttgtgccagcagttgtgctttca
gcagctgaacaatcgattgatgtgctcgatgtaaacggcgagaagcgcacaattacctgg
gaaggcttagactgggctagacgctatattaccgactttaggcaaggcagtgagcctgaa
actgcatcggatattacgcaacctggcgcggttatttatattcgtgagcaggacgacgca
tggcgtatcgcacaactccctgaagtgagcggagcctttattgcgctcaacccacgaaat
ggtgcggttgaagcggtagttggcgggtatagcttttatcaaagccagtttaatcgtgcc
acacaggctaaacgacaagtaggctctaacattaagccctttatttattctgcggctata
gacagtgggtacacccttgcttccattattaatgatgcacctattaaccaatggaatgcg
gcgaccggtgttgcgtggcgcccccaaaattcaccggctgagtacgatggccctattcgt
atgcgtaaagccttgggtaaatcaaaaaacgtagtgtcagttcgtctattgcggggggtt
gggcttcgtaaagcggccgattatcttacccgctttggttttgatccagacgatatcccg
ttagatgaaaccgtatcgttaggctctagctctcataccccgctagaggtggttcgtggt
atgtcagttattgctaatggcggctacttagtaaaccctcactttatcgctaaagtgctg
gatgaacataatcaagtattgtggcaagccaatcctgtatgggcatgcgacaattgcacc
aaggctcatgcacctgaaagctatccagaaagtgatttagatagcggtttggacaacaat
gaggttgatgtagaagccttactcgaagcccagctcaataaagatgtgttgctcgctgaa
aacgaaacagctgaaaagcaaagtgcgccgcaagttattaccgcacaaaatgctttcttg
gtcggtgagatgatgcgtaccggtgtgcgagcaaatgggaattggagtaagaagacctat
tggcttggtacaggttggcgagcacgaaatattcttcagcgcactgatattgccggtaaa
accggtaccacgaacgattcaagagatacgtggttcagtggtttccaaaaagatatcgtt
gcgactgcgtgggtgggttttgacaacatgggcagacaacttggccgcgcgacccgcaac
caaaacctcgtcaatcgcaatcctgaaaaattcaattggattggtaatgcgttaattggt
accgaagacggtgccaaagcagcaggtccggcatggataagatttatggaatatgcgttg
gcagggaagcctcattcacctatccctgtacctgagaaaatagtacgagttcgcattgat
cgtaccagtgggaagttgacccgaaggacagaccatacgacactgttcgaatatttcttg
caaggcactgaacccacctcatatgttcttgatgatgaagtggtcgaccctgcctcgcaa
aataaaacaacgacgcctgaacctgaagaaatattttaa

DBGET integrated database retrieval system